SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001625 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001625
Domain Number 1 Region: 82-167
Classification Level Classification E-value
Superfamily PDZ domain-like 1.31e-17
Family PDZ domain 0.0000725
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001625   Gene: ENSMPUG00000001642   Transcript: ENSMPUT00000001659
Sequence length 185
Comment pep:novel scaffold:MusPutFur1.0:GL897086.1:57458:62120:-1 gene:ENSMPUG00000001642 transcript:ENSMPUT00000001659 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVEVHRPDSEPDVNEVRALPQTRTTSTLSQLSDSGQTLSEDSGVDAGEAEASAPGRGRQM
ASTKSRSSKEPPRNERTTEGATKPPGLLEPTSTLVRVKKSAATLGIAIEGGANTRQPLPR
IVTIQRGGSAHNSGQLKVGHVILEVNGLTLRGKEHREAARIIAEAFKTKERDYIDFLVTE
FNVML
Download sequence
Identical sequences M3XRC5
ENSMPUP00000001625 ENSMPUP00000001625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]