SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001660 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000001660
Domain Number - Region: 196-293
Classification Level Classification E-value
Superfamily Ras GEF 0.0471
Family Ras GEF 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001660   Gene: ENSMPUG00000001676   Transcript: ENSMPUT00000001694
Sequence length 344
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897086.1:215819:243379:1 gene:ENSMPUG00000001676 transcript:ENSMPUT00000001694 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACEPQMGPSGAASPLPTSSPGWSALPGGSPPGWGQELHNGQVLTVLRIDNTCAPISFDL
GAAEEQLQTWGIQVPADQYRSLAESALLEPQVRRYIIYNSRPMRLAFAVVFYVVVWANIY
STSQMFALGNHWVGVLLVTLVAMSLTLTLVLIFERHQKKANNNTDLRLAAANGALLRHRV
LLGVTDTVEGCQSVIQLWFVYFDLEDCVQFLCDHIQEMKMSQESLLRSRLSQLCVVMETG
VSPETGEGPENLMEEAPLLPSGSHPQEPPLMQTELRQLVPEAEPEEMAQQLLAVFGGYYI
RLLVTSQLPQAVGTRHTDSARIPCPCQLIEAHILGPECCPFLAR
Download sequence
Identical sequences M3XRG0
ENSMPUP00000001660 ENSMPUP00000001660 XP_004774112.1.14098 XP_004774113.1.14098 XP_012902062.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]