SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001689 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001689
Domain Number 1 Region: 92-218
Classification Level Classification E-value
Superfamily PH domain-like 2.1e-25
Family Pleckstrin-homology domain (PH domain) 0.0000246
Further Details:      
 
Domain Number 2 Region: 795-853,926-996,1067-1118,1307-1498
Classification Level Classification E-value
Superfamily ARM repeat 0.0000148
Family Mo25 protein 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001689   Gene: ENSMPUG00000001706   Transcript: ENSMPUT00000001724
Sequence length 2009
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896983.1:5951103:6090488:-1 gene:ENSMPUG00000001706 transcript:ENSMPUT00000001724 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFPMEDISISVISRQRRTVQSTVPEDAEKRAQSLFVKECIKTYSTDWHVVNYKYEDFSGD
FRMLPCKSLRPEKIPSHVFEIDEDCEKDEDSSSLCSQKGGVIKQGWLHKANVNSTITVTM
KVFKRRYFYLTQLPDGSYILNSYKDEKNSKESKGCIYLDACIDVVQCPKMRRHAFELKML
DKYSHYLAAETEQEMEEWLLTLKKIIQINTDSLVQEKKEPVETTQEDETSSQGKAENIMA
SLERSMHPELMKYGRETEQLNKLSRGDGRQNLFSFDSEVQRLDFSGIEPDIKPFEEKCNK
RFLVNCHDLTFNILGQVGDNVKGPPTNVEPFFINLALFDVRNNCKISADFHVDLNPPSVR
EMLWGPSTQLAGDGSLKSSSPESFIHGIAESQLRYIKQGIFSVTNPHPEIFLVARIEKVL
QGNIAHCAEPYIKNSDPAKTAQKVHRTAKQVCSRLGQYRMPFAWAARPIFKDTQGSLDLD
GRFSPLYKQDSSKLSNEDILKLLSEYKKPEKTKLQIIPGQLNVTVECVPVELSNCITSSY
VPLKPFEKNCQNITVEVEEFVPEMTKYCYPFTVYKNHLYVYPLQLKYDSQKTFAKARNIA
VCVEFRDSDESDAGALKCIYGKPAGSVFTTNAYAVVSHHNQNPEFYDEIKIELPIHLHQK
HHLLFTFYHVSCEINTKGTTKKQDTVETPVGFAWVPLLKDGRIITFEQQLPVSANLPPGY
LHLNDAESRRQSNVDIKWVDGAKPLLKIKSHLESTIYTQDLHVHKFFHHCQLIQSGSKEV
PGELIKYLKCLHAMEIQVMIQFLPVILMQLFRVLTNMTHEDDVPINCTMVLLHIVSKCHE
EGLDNYLRSFIKYSFRPEKPSAPQAHLIHETLATTMIAILKQSADFLAINKLLKYSWFFF
EIIAKSMATYLLEENKIKLPRGQRFPEAYHHVLHSLLLAIIPHVTIRYAEIPDESRNVNY
SLASFLKRCLTLMDRGFVFNLINDYISGFSPKDPKVLAEYKFEFLQTICNHEHYIPLNLP
MAFAKPKLQRVQDSNLEYSLSDEYCKHHFLVGLLLRETSIALQDNYEIRYTAISVIKNLL
IKHAFDTRYQHKNQQAKIAQLYLPFVGLLLENIQRLAGRDTLYSCAALPNSASRDEFACG
FTSPTSRGSLSSDKDTAYGSFPNGHGIKREDSRGSLLPEGATGFPDQSGTVENTRQGSTR
SSVSQYNRLDQYEIRSLLMCYLYIVKMISEDTLLTYWNKVSPQELINILILLEVCLFHFR
YMGKRNIARIHDAWLSKHFGIDRKSQTMPALRNRSGVMQARLQHLSSLESSFTLNHSSAT
TEADIFHQALLEGNTATEVSLTVLDTISFFTQCFKSQLLNNDGHNPLMKKVFDIHLAFLK
NGQSEASLKHVFASLRAFISKFPSAFFKGRVNMCAAFCYEVLKCCTSKISSTRNEASALL
YLLMRNNFEYTKRKTFLRTHLQIIIAVSQLIADVALSGGSRFQESLFIINNFANSDRPMK
ATAFPAEVKDLTKRIRTVLMATAQMKEHEKDPEMLIDLQYSLAKSYASTPELRKTWLDSM
AKIHIKNGDFSEAAMCYVHVAALVAEFLHRKKLFPNGCSAFKKITPNIDEEGAMKEDAGM
MDVHYSEEVLLELLEQCVDGLWKAERYEVISEISKLIIPIYEKRREFEKLTQVYRTLHGA
YTKVLEVMHTKKRLLGTFFRVAFYGQSFFEEEDGKEYIYKEPKLTGLSEISLRLVKLYGE
KFGTENVKIIQDSDKVNAKELDPKYAHIQVTYVKPYFDDKELTERKTEFERNHNISRFVF
EAPYTLSGKKQGCIEEQCKRRTILTTSNSFPYVKKRIPISYEQQINLKPIDVATDEIKDK
TAELNKLCSSADVDMIQLQLKLQGCVSVQVNAGPLAYARAFLNDSQATKYPPKKVNELKD
MFRKFIQACSIALELNERLIKEDQIEYHEGLKSNFRDMVKELSDIIHEQILQEDTIHSPW
MSNTFHVFCAISGTSSDRGYGSPRYTAEI
Download sequence
Identical sequences M3XRI9
ENSMPUP00000001689 ENSMPUP00000001689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]