SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001698 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001698
Domain Number 1 Region: 240-312
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 3.49e-21
Family Intermediate filament protein, coiled coil region 0.00059
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000001698
Domain Number - Region: 148-237
Classification Level Classification E-value
Superfamily Prefoldin 0.00194
Family Prefoldin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001698   Gene: ENSMPUG00000001716   Transcript: ENSMPUT00000001734
Sequence length 312
Comment pep:known_by_projection scaffold:MusPutFur1.0:AEYP01112084.1:21:2633:-1 gene:ENSMPUG00000001716 transcript:ENSMPUT00000001734 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPYGNRSMEMKITIIVPKQPPKNKWAIEVGGRGKDMRNWGNTHTHTHTHTQKVCGGVSG
RKTQFGPICFVESGDPRLILLYYLHLWLNYVLPCSNSRYEDEINKRTAAENEFVTLKKDV
DAAYMNKVELQAKVDALTDEINFTRALYDAELSQMQTHVSDTSVVLSMDNNRNLDLDSII
AEVKAQYEEIAQRSRAEAESWYQSKYEELQLTAGRHGDDLRNTKQEISEINRMIQRLRSE
IDHVKKQCANLQSAIADAEQRGEMALKDAKNKLAGLEDALQKAKQDMARLLKEYQELMNV
KLALDVEIATYR
Download sequence
Identical sequences M3XRJ8
ENSMPUP00000001698 ENSMPUP00000001698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]