SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001711 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001711
Domain Number 1 Region: 293-406
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 7.4e-39
Family Synaptotagmin-like (S variant) 0.00000617
Further Details:      
 
Domain Number 2 Region: 433-527,575-616
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.84e-32
Family Synaptotagmin-like (S variant) 0.000000962
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001711   Gene: ENSMPUG00000001729   Transcript: ENSMPUT00000001747
Sequence length 638
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897027.1:613133:624783:1 gene:ENSMPUG00000001729 transcript:ENSMPUT00000001747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGDYEDDLCRRALILVSDLCARVRDADTSDRCQEFNDLRIRGYPRGPDADISVSLLSVI
VTFCGIVLLGVSLFVSWKLCWVPWRDKGGSAVGGGPLRKDLGPGVGLAGLVGGGGHHLGA
GLGGHPLLGGPHHHAHTAHHPPFAELLEPGSLGGSDPPEPSYLDMDSYPEAAAAAVAAGV
KPSQTSPELPSEGGAGSGLLLLPPSGGGLPSAQSHQQVTSLAPTTRYPALPRPLTQQTLT
PQPDPGSEERPPALPLPLPGGEEKAKLIGQIKPELYQGTGPGGRRGGGAPGSGDAGGGAP
CGRISFALRYLYGSDQLVVRILQALDLPAKDSNGFSDPYVKIYLLPDRKKKFQTKVHRKT
LNPVFNETFQFSVPLAELAQRKLHFSVYDFDRFSRHDLIGQVVLDNLLELAEQPPDRPLW
RDIVEGGSEKADLGELNFSLCYLPTAGRLTVTIIKASNLKAMDLTGFSDPYVKASLISEG
RRLKKRKTSIKKNTLNPTYNEALVFDVAPESVESVGLSIAVVDXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXPPLLTAARSPSIGHNEVIGVCRVGPDAADPHGREHWAE
MLANPRKPVEHWHQLVEEKTLSSFTKGSKGLSEKENSE
Download sequence
Identical sequences M3XRL1
ENSMPUP00000001711 ENSMPUP00000001711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]