SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001742 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001742
Domain Number 1 Region: 279-412,714-889
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 6.32e-53
Family Diacylglycerol kinase-like 0.013
Further Details:      
 
Domain Number 2 Region: 11-134
Classification Level Classification E-value
Superfamily PH domain-like 2.19e-29
Family Pleckstrin-homology domain (PH domain) 0.0037
Further Details:      
 
Domain Number 3 Region: 1093-1159
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.24e-19
Family SAM (sterile alpha motif) domain 0.0028
Further Details:      
 
Domain Number 4 Region: 181-249
Classification Level Classification E-value
Superfamily Cysteine-rich domain 3.59e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000483
Further Details:      
 
Domain Number 5 Region: 118-175
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000359
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001742   Gene: ENSMPUG00000001760   Transcript: ENSMPUT00000001778
Sequence length 1167
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896968.1:5943066:6040573:-1 gene:ENSMPUG00000001760 transcript:ENSMPUT00000001778 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KQSTMWTVRTKTSIKEGQLLKQTSSFQRWKKRYFKLRGRTLYYAKDSKSLIFDEVDLSDA
SVAEASTKNANNSFTIITPFRRLMLCAENRKEMEDWMSSLKSVQTREPYEVAQFNVEHFS
GMHNWYACSHARPTFCNVCRESLSGVTSHGLSCEVCKFKAHKRCAVRATNNCKWTTLASI
GKDIIEDEDGVAMPHQWLEGNLPVSAKCAVCDKTCGSVLRLQDWKCLWCKTMVHTACKDL
YHPVCPLGQCKVSVIPPIALNSTDSDGFCRATFSFCVSPLLVFVNSKSGDNQGVKFLRRF
KQLLNPAQVFDLMNGGPHLGLRLFQKFDNFRILVCGGDGSVGWVLSEIDKLNLNKQCQLG
VLPLGTGNDLARVLGWGGSYDDDTQLPQILEKLERASTKMLDRWSIMTYELKLPPKASLL
PEPPEASEEFYMTIYEDSVAAHLTKILNSDEHAVVISSAKILCETVKDFVAKVEKAYEKT
LENTVAADAMASKCSVLNEKLEQLLQALHTDSQATPVLPGIHSLIVEEDTVESSSEESLC
ESKEQLVDDPAKPPSQKAVKPKEIMLRANSLKKAVRQVIEEAGKVMDDQSVHPCEPVSQS
FDNDSTETDESKEESKDDDTRESLTVKAAPAPRSPDGRASRSQADSGSGPTVAAGKENLP
VLNTRIICPGLRAGLAASIAGSSIINKMLLANIDPFGATPFIDPDPDSVDGYSEKCVMNN
YFGIGLDAKISLEFNNKREEHPEKCRSRTKNLMWYGVLGTRELLQRSYKNLEQRVQLECD
GQYIPLPSLQGIAVLNIPSYAGGTNFWGGTKEDDIFAAPSFDDKILEVVAIFDSMQMAVS
RVIKLQHHRIAQCRTVKITIFGDEGVPVQVDGEAWVQPPGIIKIVHKNRAQMLTRDRAFE
STLKSWEDKQKCDSGKPVLRTHLYIQHAVDLATEEVSQMQLCSQAAEELITRICDAATIH
CLLEQELAHAVNACSHALNKANPRFPESLTRDTATEIAINVKALYNETESLLVGRVPLQL
ESPHEERVSNALHSVEVELQKLTEIPWLYYILHPNEDAEPPMDCTKRNSRSTVFRIVPKF
KKEKVQKQKTSSQPVQKWGTEEVAAWLELLSLGEYREIFIRHDIRGAELLHLERRDLKDL
GITKVGHMKRILQGIKELGRSPPQAEL
Download sequence
Identical sequences M3XRP2
ENSMPUP00000001742 ENSMPUP00000001742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]