SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001749 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001749
Domain Number 1 Region: 569-753
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.36e-53
Family DBL homology domain (DH-domain) 0.000000164
Further Details:      
 
Domain Number 2 Region: 761-890
Classification Level Classification E-value
Superfamily PH domain-like 4.87e-35
Family Pleckstrin-homology domain (PH domain) 0.0000114
Further Details:      
 
Domain Number 3 Region: 985-1040
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000494
Family SH3-domain 0.0031
Further Details:      
 
Domain Number 4 Region: 235-381
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000733
Family Spectrin repeat 0.009
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000001749
Domain Number - Region: 53-146
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.000249
Family CRAL/TRIO domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001749   Gene: ENSMPUG00000001767   Transcript: ENSMPUT00000001785
Sequence length 1067
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897083.1:952263:1023316:1 gene:ENSMPUG00000001767 transcript:ENSMPUT00000001785 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQDIAFLSGGRGKENDWIITFPENCNFRCIPEEVIAKVLTYLTSLARQNGSDSRFTIILD
RRLDTWSSLKISLQKISVSFPGNLHLVLVLRPTSFLQRTFTDIGFRFSQEDFMLKLPVVM
LSSVSDLLTYIDDKQLTPELGGTLQYCHSEWIIFRNAIENFALTVKEMAQMLQSFGTELA
ETELPDDIPSIEEILAVRAERYHMLKNDITAVTKEGKILLTSLEVPSAEDPVGSRLEHRH
HVNGDWQTVNKLLTQVHDMEIAFDGFWEKHQLKMQQYLQLWKFEQDFQELVSEVELLLNQ
QAELADVTGNIGQVKQKIKKLENLDENSQDLLAKARFVILHGHRLAANHHYALDLICQRC
NELRYLSDILVNEIKARRIQLSRIFKMHKLLQQARQCCDEGECLLANQEIDKFQSKEDAQ
KALRDIENFLEMALPFINYDPDTLQYEFDVILSPELKVQMQTVQLKLEHIRSAFENQQAG
FRNLTDKNMKPVEFVVPASDNLMRSRASFSPKHVGVGYSFFQACKLFSKGKKTWRQNQSN
LKIEVVHDGREKRSSGQSSSLDNDNTLDVLQNHVLNELIQTERVYVRELFTVLLGYRAEM
DNPEMFDLMPPLLRNKKDVLFGNMAEIYEFHNNIFLNSLENCVDAPERVGPCFLERKDDF
QMYAKYCQNKPRSEAIWKKYSECAFFQECQRKLKHRLGLDSYLLKPVQRITKYQLLLKEL
LKYSKGCRGFEQLKEALDTMLDLLKSVNDSMHQIAINGYIGNLNELGKMIMQGAFSVWTG
HKKGATKMKDFARFKPMQRHLFLYEKAIVFCKRRVESGEGSDRYPSYSFKHCLKMDEVGI
TEYVKGDNRKFEIWYAGKEEVYIVQAPNVDVKMTWLKEIRSILLKQQELLTVKKRKQHNP
LTDPDHLSSQRNDERQHGSFLGAEEPAPEPSGALAEVQEAVPLVRAEANTGWTQMSTPAE
ISEDPEEWPSNYFYASYDDNEESPGKYKALADCRKRGPEDLLIRNGDVIQFLHEDVEGQW
LVKNLNRRKEGLIPGNTAQVLIGDYRFRNAKVPGLQDSKLKTPSVFT
Download sequence
Identical sequences M3XRP9
ENSMPUP00000001749 XP_004773695.1.14098 ENSMPUP00000001749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]