SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001766 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001766
Domain Number 1 Region: 618-644,675-914
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.69e-63
Family Nuclear receptor ligand-binding domain 0.00000000138
Further Details:      
 
Domain Number 2 Region: 565-643
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.83e-23
Family Nuclear receptor 0.0000286
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001766   Gene: ENSMPUG00000001784   Transcript: ENSMPUT00000001802
Sequence length 934
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897272.1:550252:658907:-1 gene:ENSMPUG00000001784 transcript:ENSMPUT00000001802 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEPKAKDSQAPHLAGGAPSPTRVGLALSGRRDAGSFQASQTSDASPVVSAIPISLDRLL
FPPPSQGQDPDRKTQDQQPLSDVKAAHTRVEAASGAGVGNSRTPEKDRGLLDSVLDTLLE
PSGPGQSHASPPACESTSPWCLFSSELSEDPRVASTTQGVLSPLMSRPESKAGDSSGTAT
AHKVLPRGLSPSRQLLTLTSGSHPWRGAAVKPAPQQAVVDVEEEDGFESEGSVGPPLKGK
SRPVGGSAAAGGAAATSPGVASGGVTLIPKEDSRFLAPKVSLTEQEALAAPGGSPLANTM
MDFIHVPILPLNSAFLAARTRQLLEGESYDGGAAAVSTFAPPRGSPSGSSTQVAAGDFSD
CAYPPDAEPKDDGFPLYGDFQPPALKIKEEEEGTEAAARSQRQYLMTGPNPAVFPDLPLA
LQQLPPRAPSSRPGEAXXXXXXXXPASVSVSSVSSSGSTLECILYKAEDTPPQQGPFAPP
PCKAPSAGACLLPRDSASTSASAIAAGVAPALYPQLSLNGLPQLGYQAAVLKEGLPQVYQ
PYLNYLRPDSDASQSPQYSFESLPQKICLICGDEASGCHYGVLTCGSCKVFFKRAMEGQH
NYLCAGRNDCIVDKIRRKNCPACRLRKCCQAGMVLGGRKFKKFNKVRVMRALDAVALPQS
VGIPNESQALSQRISFSPTQDIQLVPPLINLLMSIEPEVIYAGHDNTKPDTSSSLLTSLN
QLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQMLYFA
PDLILNEQRMKESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTIPLEGLRSQN
QFEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSR
ALSVEFPEMMSEVIAAQLPKILAGMVKPLLFHKK
Download sequence
Identical sequences M3XRR6
ENSMPUP00000001766 ENSMPUP00000001766 XP_004780927.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]