SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001767 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001767
Domain Number 1 Region: 119-503
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.3e-135
Family Myotubularin-like phosphatases 0.0000000501
Further Details:      
 
Domain Number 2 Region: 5-114
Classification Level Classification E-value
Superfamily PH domain-like 1.13e-18
Family GRAM domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001767   Gene: ENSMPUG00000001785   Transcript: ENSMPUT00000001803
Sequence length 573
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897016.1:1600459:1659358:1 gene:ENSMPUG00000001785 transcript:ENSMPUT00000001803 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFAELIKTPRVDNVVLHRPFYPAVEGTLCLTGHHLILSSRQDNTEELWLLHSNIDAIDK
RFVGPLGTIIIKCKDFRIIQLDIPGMEECLNIASSIEALSTLDSITLMYPFFYRPMFEVM
EDGWHSFLPEQEFELYSSATSEWRLSYVNKEFAVCPSYPPIVIVPKSIDDEALRKVAAFR
HGGRFPVLSYYHKKNGMVIMRSGQPLTGTNGRRCKEDEKLINATLRAGKRGYIIDTRSLN
VAQQARAKGGGFEQEAHYPQWRRIHKSIERYHILQESLIKLVEACNDQTHNMDRWLGRLE
ASNWLTHIKEILTTACLAAQCIDREGASILIHGTEGTDSTLQVTSLAQIILEPRSRTIRG
FEALIEREWLQAGHPFQQRCAQSAYCNSKQKWESPVFLLFLDCVWQILRQFPCSFEFNEN
FLIMLFEHAYASQFGTFLGNNESERCKLKLQQKTMSLWSWVNRPGELSKFTNPLFEANNL
VIWPSVAPQSLQLWEGIFLRWNRSSKYLDEAYEEMVNIIEYNKELQAKCSRPVKDMINLF
REYLLVLKKIRLLNTPNTEIFFKTEMVDKPRIL
Download sequence
Identical sequences M3XRR7
ENSMPUP00000001767 ENSMPUP00000001767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]