SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001772 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001772
Domain Number 1 Region: 232-306
Classification Level Classification E-value
Superfamily SH3-domain 3.02e-18
Family SH3-domain 0.00062
Further Details:      
 
Domain Number 2 Region: 82-140
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000111
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.006
Further Details:      
 
Domain Number 3 Region: 308-364
Classification Level Classification E-value
Superfamily SH3-domain 0.0000294
Family SH3-domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001772   Gene: ENSMPUG00000001790   Transcript: ENSMPUT00000001808
Sequence length 364
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897076.1:1564691:1570583:-1 gene:ENSMPUG00000001790 transcript:ENSMPUT00000001808 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEKEVLESPKPSLPGETRQSGLQRLKQLFRKESRGTKEMELPPEPQANGEAVGAGGGPI
YYIYEEEEEEEEEEEEPPPEPPKLVNDKPHKFKDHFFKKPKFCDVCARMIVLNNKFGLRC
KNCKTNIHEHCQSYVEMQRCFGKIPPGFHRAYSSPLYSNQQYACVKDLSAANHNDPVFET
LRTGVIMANKERKKGQADKKNPLAAMMEEEPESARPEEGKTQDGNPEGNKKAEKKTPDDK
HKQPGFQQSHYFVALYRFKALEKDDLDFPPGEKITVIDDSNEEWWRGKIGEKVGFFPPNF
IIRVRSGERVHRVTRSFVGNREIGQITLKKDQIVVQKGDEAGGYVKVYTGRKVGLFPTDF
LEEI
Download sequence
Identical sequences M3XRS2
ENSMPUP00000001772 ENSMPUP00000001772 XP_004773258.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]