SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001798 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001798
Domain Number 1 Region: 263-323
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.55e-18
Family Erythroid transcription factor GATA-1 0.00043
Further Details:      
 
Domain Number 2 Region: 211-261
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.08e-16
Family Erythroid transcription factor GATA-1 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001798   Gene: ENSMPUG00000001816   Transcript: ENSMPUT00000001834
Sequence length 442
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897016.1:2038627:2093739:1 gene:ENSMPUG00000001816 transcript:ENSMPUT00000001834 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYQSLAMAANHGPPPGAYEAGGPGAFMHSAGAASSPVYVPTPRVPSSVLGLSYLQGGGGG
AASGATSGGSSGGAPSGAGPGTQQGSPGWSQAGAEGAAYTPPPVSPRFSFPGTTGSLAAA
APPAAAREAAAYSSGSGAAGAGLTGREQYGRAGFAGSYSSPYPAYMADVGASWAAAAAAS
AGPFDSPVLHSLPGRANPAARHPNLDMFDDFSEGRECVNCGAMSTPLWRRDGTGHYLCNA
CGLYHKMNGINRPLIKPQRRLSASRRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMK
LHGVPRPLAMRKEGIQTRKRKPKNLNKSKTPAGPSGGESLPPASSASSNSSNAATSSSEE
MRPIKTEPGLSSHYGHSSSMSQTFSVSAMSSHGPSIHPVLSALKLSPQGYASSVSQSPQP
SSKQDPWNSLALADSHGDIITA
Download sequence
Identical sequences M3XRU8
ENSMPUP00000001798 ENSMPUP00000001798 XP_004766135.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]