SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001843 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001843
Domain Number 1 Region: 112-164
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000000000955
Family Hairy Orange domain 0.0000529
Further Details:      
 
Domain Number 2 Region: 50-105
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000222
Family HLH, helix-loop-helix DNA-binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001843   Gene: ENSMPUG00000001859   Transcript: ENSMPUT00000001879
Sequence length 304
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897090.1:2986826:2990927:1 gene:ENSMPUG00000001859 transcript:ENSMPUT00000001879 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRAHPEYSSSDSELDETIEVEKESADENGNLSSALGSMSPTTSSQILARKRRRGIIEKR
RRDRINNSLSELRRLVPSAFEKQGSAKLEKAEILQMTVDHLKMLHTAGGKGYFDAHALAM
DYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLGHIPW
GSAFGHHPHVAHPLLLPQNGHGNTGTTASPTEPHHQGRLASAHPEAPALRAPPSGGLGPV
LPVVTTASKLSPPLLSSVASLSAFPFSFGSFHLLSPNALSPSAPTQAANLGKPYRPWGTE
IGAF
Download sequence
Identical sequences M3XRZ3 U6CPW5
ENSMPUP00000001843 ENSMPUP00000001843 XP_004774292.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]