SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001861 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001861
Domain Number 1 Region: 2219-2540
Classification Level Classification E-value
Superfamily BEACH domain 2.22e-121
Family BEACH domain 0.0000000000153
Further Details:      
 
Domain Number 2 Region: 165-356
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.62e-33
Family Clostridium neurotoxins, the second last domain 0.028
Further Details:      
 
Domain Number 3 Region: 2657-2910
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.51e-30
Family WD40-repeat 0.0063
Further Details:      
 
Domain Number 4 Region: 2107-2214
Classification Level Classification E-value
Superfamily PH domain-like 3.63e-30
Family PreBEACH PH-like domain 0.00000224
Further Details:      
 
Domain Number 5 Region: 448-555,634-930
Classification Level Classification E-value
Superfamily ARM repeat 5.28e-17
Family Plakophilin 1 helical region 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001861   Gene: ENSMPUG00000001876   Transcript: ENSMPUT00000001897
Sequence length 2923
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897055.1:1605693:2285090:-1 gene:ENSMPUG00000001876 transcript:ENSMPUT00000001897 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGELRGASGSGSVVLPAGMINPSVPIRNIRMKFAVLIGLIQVGEVSNRDIVETVLNLLVG
GEFDLEMNFIIQDAESITCMTELLEHCDVTCQAEIWSMFTAILRKSVRNLQTSTEVGLIE
QVLLKMSAVDDMIADLLVDMLGVLASYSITVKELKLLFSMLRGESGIWPRHAVKLLSVLN
QMPQRHGPDTFFNFPGCSAAAIALPPIAKWPYQNGFTLNTWFRMDPLNNINVDKDKPYLY
CFRTSKGVGYSAHFVGNCLIVTSLKSKGKGFQHCVKYDFQPRKWYMISIVHIYNRWRNSE
IRCYVNGQLVSYGDMAWHVNTNDSYDKCFLGSSETADANRVFCGQLGAVYVFSEALNPAQ
IFAIHQLGPGYKSTFKFKSESDIHLAEHHKQVLYDGKLASSIAFTYNAKATDAQLCLESS
PKENASIFVHSPHALMLQDVKAIVTHSIHSAIHSIGGIQVLFPLFAQLDNRQLNDSQVET
TVCATLLAFLVELLKSSVAMQEQMLGGKGFLVIGYLLEKSSRVHITRAVLEQFLSFAKYL
DGLSHGAPLLKQLCDHILFNPAIWIHTPAKVQLSLYTYLSAEFIGTATIYTTIRRVGTVL
QLMHTLKYYYWVINPADSSGITPKGLDGPRPSQKEIISLRAFMLLFLKQLILKDRGVKED
ELQSILNYLLTMHEDENIHDVLQLLVALMSEHPASMIPAFDQRNGIRVIYKLLASKSESI
WVQALKVLGYFLKHLGHKRKVEIMHTHSLFTLLGERLMLHTNTVTVTTYNTLYEILTEQV
CTQVVHKPHPEPDSTVKIQNPMILKVVATLLKNSTPSPELMEVRRLFLSDMIKLFSNSRE
NRRCLLQCSVWQDWMFSLGYINPKNSEEQKITEMVYNIFRILLYHAIKYEWGGWRVWVDT
LSIAHSKVTYEAHKEYLAKMYEEYQRQEEENIKKGKKGNVSTISGLSSQTTGAKGGMEIR
EIEDLSQSQSPESETDYPVSTDTRDLLMSTKVPDDILGNSDRPGSGVHVEVHDLLVDIKA
EKVEATEVKLDDMDLSPETLVGGENGALVEVESLLDNVYSAAVEKLQNNVHGSVGIIKKN
EEKDNGPLITLADEKDELPNSSTSFLFDKIPKQEEKLLPELSSNHIIPNIQDTQVHLGVS
DDLGLLAHMTGSVDLSCTSSIIEEKEFKIHTTSDGMSSISERDLASSSKGLEYAEMTATT
LETESSGSKIVPNIDAGSIISDTERSDDGKESGKEIRKIQTTATTQAVQGRSITQQDRDL
RVDLGFRGMPMTEEQRRQFSPGPRTTMFRIPEFKWSPMHQRLLTDLLFALETDVHVWRSH
STKSVMDFVNSNENIIFVHNTIHLISQMVDNIIIACGGILPLLSAATSPTTELENIEVTQ
GMSAETAVTFLSRLMAMVDVLVFASSLNFSEIEAEKNMSSGGLMRQCLRLVCCVAVRNCL
ECRQRQRDRGSKSSHGSSKPQEVPQSVTATAASKTPLESVPGNLSPIKDPDRLLQDVDIN
RLRAVVFRDVDDSKQAQFLALAVVYFISVLMVSKYRDILEPQRETARTGSQQGRNIRQEI
NSPTSTVVVIPSIPHPSLNHGFLAKLIPEQSFAHSFYKETPATFPDTIKEKETPTPGEDI
QLESSIPHTDSGIGEEQVASILNGAELETGTGPDAMSELLSTLSSEVKKSQESLTENPSE
LLKPAPSISSISQTKGINVKEILKSLVAAPVEIAECGPEPIPYPDPTLKREAQAILPMQF
HSFDRSVVVPVKKPPPGSLAVTTVGATAAGSGLPTGSTSNIFAATGATPKSMINTTGAVD
SGSSSSSSSSSFVNGATSKNLPAVQTVAPMPEDSAENMSITAKLERALEKVAPLLREIFV
DFAPFLSRTLLGSHGQELLIEGLVCMKSSTSVVELVMLLCSQEWQNSIQKNAGLAFIELI
NEGRLLCHAMKDHIVRVANEAEFILNRQRAEDVHKHAEFESQCAQYAADRREEEKMCDHL
ISAAKHRDHVTANQLKQKILNILTNKHGAWGAVSHSQLHDFWRLDYWEDDLRRRRRFVRN
AFGSTHAEALLKAAVEYGTEEDVVKSKKAFRSQAIVNQNAETELMLEGDDDAVSLLQEKE
IDNLAGPVVLSTPAQLIAPVVVAKGTLSITTTEIYFEVDEDDPAFKKIDTKVLAYTEGLH
GKWMFSEIRAVFSRRYLLQNTALEVFMANRTSVMFNFPDQATVKKVVYSLPRVGVGTSYG
LPQARRISLATPRQLYKSSNMTQRWQRREISNFEYLMFLNTIAGRTYNDLNQYPVFPWVL
TNYESEELDLTLPGNFRDLSKPIGALNPKRAVFYAERYETWEDDQSPPYHYNTHYSTATS
TLSWLVRIEPFTTFFLNANDGKFDHPDRTFSSVARSWRTSQRDTSDVKELIPEFYYLPEM
FVNSNGYNLGVREDEVVVNDVGLPPWAKKPEDFVRINRMALESEFVSCQLHQWIDLIFGY
KQRGPEAVRALNVFHYLTYEGSVNLDSITDPVLREILEAYFIRDPHTFLLTQDFLKAMEA
QIQNFGQTPSQLLIEPHPPRSSAMHLCFLPQSPLMFKDQMQQDVIMVLKFPSNSPVTHVA
ANTLPHLTIPAVVTVTCSRLFAVNRWHNTVGLRGAPGYSLDQAHHLPIEMDPLIANNSGV
NKRQITDLVDQSIQINAHCFVVTADNRYILICGFWDKSFRVYSTETGKLTQIVFGHWDVV
TCLARSESYIGGDCYIVSGSRDATLLLWYWSGRHHIIGDNPNSSDYPAPRAVLTGHDHEV
VCVSVCAELGLVISGAKEGPCLVHTITGDLLRALEGPENCLFPRLISVSSEGHCIIYYER
GRFSNFSINGKLLAQMEINDSTRAILLSSDGQNLVTGGDNGVVEVWQACDFKQLYIYPGC
DAGIRAMDLSHDQRTLITGMASGSIVAFNIDFNRWHYEHQNRY
Download sequence
Identical sequences M3XS11
ENSMPUP00000001861 XP_012900348.1.14098 ENSMPUP00000001861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]