SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001864 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001864
Domain Number 1 Region: 165-195
Classification Level Classification E-value
Superfamily WW domain 0.000000000371
Family WW domain 0.0011
Further Details:      
 
Domain Number 2 Region: 124-157
Classification Level Classification E-value
Superfamily WW domain 0.00000000257
Family WW domain 0.00028
Further Details:      
 
Domain Number 3 Region: 9-50
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000277
Family HkH motif-containing C2H2 finger 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001864   Gene: ENSMPUG00000001879   Transcript: ENSMPUT00000001900
Sequence length 373
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896968.1:6871490:6938251:-1 gene:ENSMPUG00000001879 transcript:ENSMPUT00000001900 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADYWKSQPKKFCDYCKCWIADNRPSVEFHERGKNHKENVAKRISEIKQKSLDKAKEEEK
ASKEFAAMEAAALKAYQEDLKRLGLESEISEPSISPVTSTIPPTSAPKQQKEKKKKKKDP
SKGRWVEGITSEGYHYYYDLITGASQWERPEGFQGNLKKIAGKTVWIEGVSEDGYTYYYN
TETGESRWEKPDDFIPHSGDLLSSKVDEKSLGTLEESKSSDSHSDSDGEEEAEKGEASTE
TQKPKIKFKEKNKNSDKGTEPETQKEKNTQEQNSSGPNEEKSKAHKKSNPYGEWQEIKQQ
VESHEEVDLELPSTENEYVSTSEPDIGGQPKVIFKEKTVTSLGVMADGVAPVFKKRRLEN
GKSRNLRQRGDDQ
Download sequence
Identical sequences M3XS14
ENSMPUP00000001864 XP_004759351.2.14098 ENSMPUP00000001864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]