SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001892 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001892
Domain Number 1 Region: 89-151
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 4.19e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001892   Gene: ENSMPUG00000001909   Transcript: ENSMPUT00000001930
Sequence length 208
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897016.1:4187985:4190629:1 gene:ENSMPUG00000001909 transcript:ENSMPUT00000001930 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTRGFCLPAAAREAGAAAAAAASRCSHEENPYFHGWLIGHPEMSPPDYSMALSYSPEYA
SGAAGLDHSHYGGVPPGAGPPGLGGPRPVKRRGTANRKERRRTQSINSAFAELRECIPNV
PADTKLSKIKTLRLATSYIAYLMDLLAKDDQNGEAEAFKAEIKKTDVKEEKRKKELNEIL
KSTVSSNDKKTKGRTGWPQHVWALELKQ
Download sequence
Identical sequences M3XS42
ENSMPUP00000001892 ENSMPUP00000001892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]