SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001911 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001911
Domain Number 1 Region: 459-492,523-601
Classification Level Classification E-value
Superfamily SpoIIaa-like 3.53e-16
Family Anti-sigma factor antagonist SpoIIaa 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001911   Gene: ENSMPUG00000001927   Transcript: ENSMPUT00000001949
Sequence length 603
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897076.1:1892252:1898440:1 gene:ENSMPUG00000001927 transcript:ENSMPUT00000001949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPPLRWLPHYRWRAWLLGDAVAGVTVGIVHVPQGMAFALLTSVPPVFGLYTSFFPVLIYT
LLGTGRHLSTGTFAVLSLMTGSAVERLVPEPLGGNLSEIEREQLDVQRVGAAAALAFGSG
ALMLGMFALQLGVLSTFLSEPVVKALTSGAALHVLVSQLPSLLGLPLPRQIGCFALFKTL
AAVLTALPRSSPAELTISALSLALLVPVKELNVRFRDKLPTPIPGEIVMVLLASVLCFTS
SLDTRYNVQIVGLLPGGFPQPRLPNLAELPRILVDSLPIALVAFAVSASLASIYADKYSY
TIDSNQELLAHGVSNLISSLFSCFPNSATLATTSLLVDAGGNTQLAGLFSCIVVLSVLLW
LGPFFYYLPKAVLACINISSMRQMFFQMQELPQLWRISRMDFAVWMVTWVAVVILSVDLG
LAIGVVFSMMTVICRTQRVQCLALGLAEGTELYRPLRESHKLRKVPGLCILSYPAPLYFG
TRGQFRRTLEQHLGLGEGGKVRDLVRGEGGFSGRGRRLQRRMAHPMQVRVVVLDCSGLTF
ADVAGAREVVQLASRCRDAGIHLLLAQCNASVLGTLTQAGLLNRVTPEQLFVSVQDAAAH
ALE
Download sequence
Identical sequences M3XS61
ENSMPUP00000001911 ENSMPUP00000001911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]