SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001918 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001918
Domain Number 1 Region: 218-459
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.15e-70
Family Nuclear receptor ligand-binding domain 0.000000000457
Further Details:      
 
Domain Number 2 Region: 85-175
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.75e-26
Family Nuclear receptor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001918   Gene: ENSMPUG00000001934   Transcript: ENSMPUT00000001956
Sequence length 460
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897027.1:785921:791242:-1 gene:ENSMPUG00000001934 transcript:ENSMPUT00000001956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTPTASSLDTPLPGNGPSQPSAPSSSPAIKEEGPELWPAGPDPDVPGSDWARSACSLTP
VVPDPAEEPERKRKKGPAPKMLGHELCRVCGDKASGFHYNVLSCEGCKGFFRRSVVRGGA
RRYACRGGGTCQMDAFMRRKCQQCRLRKCKEAGMREQCVLSEEQIRKKKIRKQQQQQQQQ
QQSPVGPAGGSSSTSGPGASPGGSDGGGQGSGEGEGVQLTAAQELMIQQLVAAQLQCNKR
SFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQI
ALLKASTIEIMLLETARRYNHETECITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAMR
RLGLDDAEYALLIAINIFSADRPNVQEPSRVEALQQPYVEALLSYTRIKRPQDQLRFPRM
LMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDVHE
Download sequence
Identical sequences M3XS68
ENSMPUP00000001918 ENSMPUP00000001918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]