SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001920 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001920
Domain Number 1 Region: 453-743
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.98e-83
Family Protein kinases, catalytic subunit 0.000000000142
Further Details:      
 
Domain Number 2 Region: 952-1089
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 1.44e-58
Family FAT domain of focal adhesion kinase 0.000000215
Further Details:      
 
Domain Number 3 Region: 176-297
Classification Level Classification E-value
Superfamily Second domain of FERM 1.18e-39
Family Second domain of FERM 0.000000506
Further Details:      
 
Domain Number 4 Region: 75-174
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.65e-39
Family First domain of FERM 0.00000228
Further Details:      
 
Domain Number 5 Region: 298-406
Classification Level Classification E-value
Superfamily PH domain-like 3.32e-37
Family Third domain of FERM 0.00000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001920   Gene: ENSMPUG00000001936   Transcript: ENSMPUT00000001958
Sequence length 1096
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896908.1:24810130:25001405:-1 gene:ENSMPUG00000001936 transcript:ENSMPUT00000001958 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLELAGRAALRPAGAVCMEKSGCSPFPVCWAKEYDRYIASSKIMAAAYLDPNLNHTPNS
CTKTHLGAGAERSPGAMERVLKVFHYFENSSEPATWASIIRHGDATDVRGIIQKIVDSHK
VKHVACYGFRLSHLRSEEVHWLHLDMGVSNVREKYELAHPPEEWKYELRIRYLPKGFLNQ
FTEDKPTLNFFYQQVKSDYMSEVADRVDQDIALKLGCLEIRRSYWEMRGNALEKKSNYEV
LEKDVGLKRFFPRSLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKE
CFKCALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFNQVQTIQYSNSEDKDRKGML
QLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGATQSFIIRPQKEGERALPSIPKP
ANSEKQGVRTHAVSVSETDDYAEIIDEEDTYTMPSTRDYEIQRERIELGRCIGEGQFGDV
HQGVYMSPENPALAVAIKTCKNSTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVW
IIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSS
NDCVKLGDFGLSRYMEDSTYYKASKGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEIL
MHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQL
STILEEEKVQQEERMRMESRRQVTVSWDSGGSDEAPPKPSRPGYPSPRSSEGFYPSPQHM
VQTNHYQVSGYPGSHGVTAMAGSIYPGQASLLDQTDSWNHRAQEISMWQPSVEDSAALDL
RGIGHVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLSRGSIDREDGSLQGPTG
NQHIYQPVGKPDPAAPPKKPPRPGAPGHLGSLASLSSPGDSYNEGVKLQPQEISPPPTAN
LDRSNDRVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETLPVLP
ASTHREIEMAQKLLNSDLGELINKMKLAQQCVMTSLQQEYKKQMLTAAHALAVDAKNLLD
VIDQARLRMLGPTRPH
Download sequence
Identical sequences M3XS70
ENSMPUP00000001920 ENSMPUP00000001920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]