SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001935 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001935
Domain Number 1 Region: 646-820
Classification Level Classification E-value
Superfamily PH domain-like 4.37e-36
Family Phosphotyrosine-binding domain (PTB) 0.0063
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000001935
Domain Number - Region: 613-653
Classification Level Classification E-value
Superfamily SH3-domain 0.00614
Family SH3-domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001935   Gene: ENSMPUG00000001952   Transcript: ENSMPUT00000001974
Sequence length 832
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897110.1:143205:157184:-1 gene:ENSMPUG00000001952 transcript:ENSMPUT00000001974 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADRAEMFSLSTFHSLSPPGCRPPQDISLEEFDDEDLSEITDDCGLGLSYDSDHCEKDSL
SLGRSEQPHPICSFQDDFQEFEMIDDNEEEEEEEEEDEEEEEEEEEEEEGEGEGKEAGGP
VSEAPAPETLIPSPSVDEPHKNRPTTLHLTTLGAQDSLNNNGGFAPVPPASWQETVLRSP
PQEPLRESPASLQPADASPRGAQSPVRLGCDCEGNRPAAGAPAPCGASPSSDPGIEADLG
SRSSGGRGGRRSSQELSSPGSDSEDAGGARLGRMISSISETELELSSDGGSSSSGRSSHL
TNSIEEASSPASEPEPEPEPEAPCEPPRRPAFLPVGPDDTNSEYESGSESEPDLSEDADS
PWLLSNLVSRMISEGSSPIRCPGQCLSPASRPSGEAASPADGATEGSEAPAGRGGVELVD
METLCGPPPPAPSAPRPGPAQPGPCLFLSNPTRDTITPLWAAAGRSARPGRSCSAACSEE
DDEDEEDEGDADDKVGPPGGRGVGPAAPLDASLVYDAVKYTLVVDEHTQLELVSLRRCAG
LGDDGSEDSGGEASEEETAAALLGGGQGPEDASPDSPDLTFSKKFLNVFVNSTSRSSSTE
SFGLFSCLVNGEEKEQTHRAVFRFIPRHPDELELDVDDPVLVEAEEDDFWFRGFNMRTGE
RGVFPAFYAHAVPGPAKDLLGSKRSPCWVERFDVQFLGSVEVPCHQGNGILCAAMQKIAT
ARKLTVHLRPPASCDLEISLRGVKLSLSGGPEFQHCSHFFQMKNISFCGCHPRNSCYFGF
ITKHPLLSRFACHVFVSQESMRPVAQSVGRAFLEYYQQHLEYACPTEDIYLE
Download sequence
Identical sequences M3XS85
ENSMPUP00000001935 XP_004775401.1.14098 ENSMPUP00000001935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]