SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001952 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001952
Domain Number 1 Region: 1-77
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.57e-18
Family SAM (sterile alpha motif) domain 0.0025
Further Details:      
 
Domain Number 2 Region: 208-294
Classification Level Classification E-value
Superfamily PDZ domain-like 2.1e-16
Family PDZ domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001952   Gene: ENSMPUG00000001970   Transcript: ENSMPUT00000001992
Sequence length 555
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897165.1:847512:938069:-1 gene:ENSMPUG00000001970 transcript:ENSMPUT00000001992 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPVTKWSPKQVVDWTRGLDDCLQQYVHKFEREKINGEQLLQISHQDLEELGVTRIGHQE
LVLEAVDLLCALNYGLETDNMKNLVLKLRASSHNLQNYISSRRKSPAYDGNTSHKPPNEF
LTSVVELIGAAKALLAWLDRAPFTGITDFSVTKNKIIQLCLDLTTTVQKDCLVAEMEDKV
LTVVKVLNGICDKTIRSTTDPVMSQCACLEEVHLPNVKPGEGLGMYIKSTYDGLHVITGT
TENSPADRSQKIHAGDEVIQVNQQTVVGWQLKNLVRKLRENPTGVVLLLKKRPTGSFNFT
PAPLKNLRWRPPLVQASPPPTTTQSPESTMDTSLKKEKPAILDLYIPPPPAVPYSPRDEN
GSFLYGGFSKCKQPLPGPKGSESPNSFLDQESRRRRFTIADSDQLPGYSVETNILPTKMR
EKTPSHGKPRPLSMPADGSWMGIVDPFARPRGHGRKGEDALCRYFSNERIPPILEERPSP
PYRFSRPPAERQLVRGADYVRGSRGYLGSDLHGSATIPFQEEGTRKKPVSSATKASSTEP
SLLVSWFTRLKLLTH
Download sequence
Identical sequences M3XSA2
ENSMPUP00000001952 ENSMPUP00000001952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]