SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001956 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001956
Domain Number 1 Region: 30-162
Classification Level Classification E-value
Superfamily ENTH/VHS domain 6.41e-30
Family RPR domain (SMART 00582 ) 0.006
Further Details:      
 
Domain Number 2 Region: 440-569
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.49e-18
Family Canonical RBD 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001956   Gene: ENSMPUG00000001974   Transcript: ENSMPUT00000001996
Sequence length 1290
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897165.1:1108988:1259239:1 gene:ENSMPUG00000001974 transcript:ENSMPUT00000001996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAVKTFNSEDCASTPACTDCFSSSMDTRSILYSLNDYKPPISKAKMTQITKAAIKAIKF
YKHVVQSVEKFIQKCKPEYKVPGLYVIDSIVRQSRHQFGQEKDVFAPRFSNNIISTFQNL
YRCPGDDKSKIVRVLNLWQKNNVFKSEIIQPLLDMAAGIPPPVVTPVLASTTAAMSNTPG
TPVTPVTPANVVQGLPDPWVSQITNTDTLAAVAQILQSPQGQQLQQLIQTLQLQQQKPQP
SILQALDAGLVVQLQALTAQLTAAAAAANTLNPLEQGVAFNKLMDRFDFGEDSEHSEEPK
KEISASQLSHVSESVNNSIFHQIAEQLQQQNLEHLRQQLLEQQQPQKATPQDSQEGTFGS
EHSASPSQGSSQQHFLEPEANLDDSIDIQQQDMDIDEGQDGVEEEIFEQEAKKVAVRSRS
RTHSRSRSRSPRKRRSRSRSGSRKRKHRKRSRSRSRERKRKSSRSYSSERRAREREKERQ
KKGLPPVRSKTLSVCSTTLWVGQVDKKATQQDLTNLFEEFGQIESINMIPPRGCAYVCMV
HRQDAFRALQKLSSGSYKIGSKVIKIAWALNKGVKTEYKQFWDVDLGVTYIPWEKVKVDD
LEGFAEGGMIDQETVNTEWETVKSSEPVKETVQTTQSPTPVEKETVVTTQAEVFPPPVAM
LQIPVAPAVPAVSLVPPAFPVSMPVPPPGFSPIPPPPFLRASFNPSQPPPGFMPPPVPPP
VVPPPTIPPVVPTSLVQPPLSMTPETVKDVGFGGLVLPGGSVASNLATSTLPAGNVFNPP
TKQGEPEEKVPHLIDHQIPSGENTRSVIPNDIPSSPAMLGGQPPNVTSNSGILGVQRPNV
SSNSEIIGIRPSNVSSSSGMIGAQPPNILNNSGILGLQPPTVSSSSGLLGVLPPNIPNNS
GLIGVQPPNVPNAAGLLGTQPPAGPQNLPPLNLSNQRMPAMPMLDIRPGLMPQTPGPRFP
LIQPGIPPQRGIPPPSVLDSPLHPPPRGPFPPGDIFSQPERPFLVPGRQSVDNVTNPEKR
IPLGNDNIQQEGDRDYRFPPIEARESISRPPPVDVREVVGRPIDPREGPGRPPLDGRDHF
GRPPVDIRENLVRPGIDHLGRRDHFGFNPEKPWGHRDFDEREHRVLPVYGGPKGLHEERG
RFRSGSYRFDPRSGPWNRGFGQEVHRDFDDRRRPWERQRDRDDRDFDFCREINGNRLGRD
RIQNTWVPPPHPRVFDFFEGATSQRKGDNVPQVNGENTERHAQPPPLPVQNDPELYEKLT
SSSEINKEKSDTVADIESEPVVESTETEGT
Download sequence
Identical sequences M3XSA6
XP_012904251.1.14098 ENSMPUP00000001956 ENSMPUP00000001956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]