SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001960 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001960
Domain Number 1 Region: 136-312
Classification Level Classification E-value
Superfamily PH domain-like 2.95e-26
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 
Domain Number 2 Region: 399-487
Classification Level Classification E-value
Superfamily PH domain-like 1.13e-19
Family Pleckstrin-homology domain (PH domain) 0.00000446
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001960   Gene: ENSMPUG00000001978   Transcript: ENSMPUT00000002000
Sequence length 860
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896997.1:380985:418911:1 gene:ENSMPUG00000001978 transcript:ENSMPUT00000002000 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSGLPSSPSHAGPQGPWRDGAGCGGVSDLALRRAGSNYKGFSFLSLALEQLLTELDDFL
KILDQENLSSTAVVKKSSLAELLRVYTKSSSSDEEYIYMNKVTVNKQQNAESQGKATEEQ
NPLANGEPGQHSLAPQKSLPDLPPPKIIPERKQLSIPKIESPEGYYEEAEPYDASLNEDG
EAVSSSYESYDEEENSKGKSAPHQWPSPEASIELMRDARICAFLWRKKWLGQWAKQLCVI
KDTRLLCYKSSKDHSPQLDVNLLGSSVIHKEKQVRKKEHKLKITPMNADVIVLGLQSRDQ
AEQWLRVIQEVSGLPVEGASDGNQYSPDVQRLNCQKLDVTEKYLSAPEYGSSIEGHAEVP
EAKDVKKKSSPGLKLSNLMNLGRKKSTSLEPPDRSLETSSYLNVLVNSQWKSRWCSVRDS
HLHFYQDRNRSKVAQQPLSLVGCEVVPDPSPDHLYSFRILHRGEEVAKLEAKSSEEMGHW
LGLLLSESGSKTDPEEFTYDYVDADRVSCIVSAAKNSLLLMQRKFSEPNTYIDGLPRQDR
QEMLYDDVETSELTAVAETPEEAAPGTDALSESPPDRVYLDLTPVKSFLHSSSGAQSRAQ
SPLPPQPDPPAETLPADPGPAPDEPLVESPENPELQTLRQESPEPEEPSLRTTTVKIQTE
QQKISFPSSCPDMAAVTPAGASPPVKERLRVASAEIKLGKNRTEAEVKRYTEEKERLEKK
KEEIRGHLAQLRKEKRELRETMLKCTDKGALASLEQRLKEIDEECRVEERRRVDLELNIV
EVKDNLKKAEAGPVTLGTTVDTTHLENVSPRPKAATPTPAPDCTPVNSATALKNRPLSVM
VTGKGTVLQKAKEWEKKGTS
Download sequence
Identical sequences M3XSB0
ENSMPUP00000001960 ENSMPUP00000001960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]