SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001961 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001961
Domain Number 1 Region: 145-207
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.02e-17
Family LIM domain 0.0012
Further Details:      
 
Domain Number 2 Region: 204-271
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.5e-16
Family LIM domain 0.0011
Further Details:      
 
Domain Number 3 Region: 83-149
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000136
Family LIM domain 0.0018
Further Details:      
 
Domain Number 4 Region: 23-87
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000285
Family LIM domain 0.0038
Further Details:      
 
Domain Number 5 Region: 268-295
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000879
Family LIM domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001961   Gene: ENSMPUG00000001979   Transcript: ENSMPUT00000002001
Sequence length 296
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897083.1:3737476:3749741:-1 gene:ENSMPUG00000001979 transcript:ENSMPUT00000002001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASHRHSGPSSYKVGTMTEKFDCHYCRDNLQGKKYVQKDGHHCCLKCFDKFCANTCAECR
KPIGADSKEVHYKNRYWHDTCFRCAKCLHPLANETFVAKDNKIFCNKCTTREDAPKCKGC
FKPIVAGDQNVEYKKTIWHKDCFTCSNCKQVIGTGSFFPKGEDFYCVTCHETKFAKHCVK
CNKAITSGGITYQDQPWHAECFVCVTCSKKLAGQRFTAVEDQYYCVDCYKNFVAKKCAGC
KNPITGFGKGSSVVAYEGQSWHDYCFHCKKCSVNLANKRFVFHEEQVYCPDCAKKL
Download sequence
Identical sequences M3XSB1
ENSMPUP00000001961 ENSMPUP00000001961 XP_004773725.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]