SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001981 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001981
Domain Number 1 Region: 914-1025
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 3.01e-40
Family Pyk2-associated protein beta ARF-GAP domain 0.00034
Further Details:      
 
Domain Number 2 Region: 403-574
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.12e-29
Family G proteins 0.0000000378
Further Details:      
 
Domain Number 3 Region: 1037-1129
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.22e-16
Family Ankyrin repeat 0.0026
Further Details:      
 
Domain Number 4 Region: 674-739,854-897
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000511
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001981   Gene: ENSMPUG00000002000   Transcript: ENSMPUT00000002022
Sequence length 1172
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897076.1:1981209:1993344:-1 gene:ENSMPUG00000002000 transcript:ENSMPUT00000002022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRGAGALQRRTTTYLISLTLVKLESVPPPPPSPSAAAAGAPGTRGAETGDPGSPRGAEE
PGKKRHERLFHRQDALWISTSSAGAGGAEPPALSPAPASPAHPVSPVPGRRLSLWAAPPG
PPLSGGLSPDPKPGGAPTSRRPLLSSPSWGGPEPEGRAGGGVPGSSSPHPGTGSRRLKVA
PPPPAPKPCKTVTTSGAKAGGGKGAGSRLSWPESEGKPRVKGSKSSAGTGASAAAAAAAA
AAAGGGGAAAPTSVGVGAGSGARGKLSPRKGKSKTLDNSDLHPGPPAGSPPPLTLPATPA
PAAAVTAASAQPTGPAPPITLEPPAPGLKRGREGGRASTRDRKMLKFISGIFTKSTGGPP
GSGPPPGPPGLSSGSGSRELLGAELRASPKAVVNSQEWTLSRSIPELRLGVLGDARSGKS
SLIHRFLTGSYQMLEKTESEQHKKEMLVDGQTHLVLIREEAGAPDAKFSGWADAVILVFS
LEDENSFQAVSRLHGQLSSLRGEGRGGLALALVGTQDRISASSPRVVGDARARALCAEMK
RCSYYETCATYGLNVDRVFQEVAQKVVTLRKQQQLLAACKSLPSSPSHSAASTPVAGQAS
NGGHTSDYSSSLPSSPNVGHRELRAEAAAVAGLSTPGSLHRAAKRRTSLFVNRRGSDSEK
RSLDSRGETTGSGRAIPIKQSFLLKRSGNSLNKEWKKKYVTLSSNGFLLYHPSINDYIHS
THGKEMDLLRTTVKVPGKRPPRAISAFGPSASINGLVKDMSTVQMGEGPEATTPTPSPSP
SPSSLQPPPDQTSKHLLKPDRNLARALSTDCTPSGDLSPLSREPPPSPMVKKQRRKKLTT
PSKTEGSAGQAEEENFEFLIVSSTGQTWHFEAASFEERDAWVQAIESQILASLQCCESSK
VKLRTDSQSEAVAIQAIRNAKGNSICVDCGAPNPTWASLNLGALICIECSGIHRNLGTHL
SRVRSLDLDDWPRELTLVLTAIGNDMANRVWESDTRGRTKPTRDSSREERESWIRAKYEQ
LLFLAPLGTSEEPLGHQLWAAVQAQDVAAVLLLLAHARHGPLDTSVEDPQLRSPLHLAAE
LAHVVITQLLLWYGADVAARDAQGHTALFYARQAGSQLCADILLQHGCPGEGGSTATTPS
AATTPSITATPSPRRRSSAASMGRADAPVALV
Download sequence
Identical sequences M3XSD1
ENSMPUP00000001981 ENSMPUP00000001981 XP_004773322.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]