SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001986 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001986
Domain Number 1 Region: 1292-1454
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-70
Family Pleckstrin-homology domain (PH domain) 0.00000356
Further Details:      
 
Domain Number 2 Region: 1080-1295
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.66e-53
Family DBL homology domain (DH-domain) 0.0000000938
Further Details:      
 
Domain Number 3 Region: 502-617
Classification Level Classification E-value
Superfamily PH domain-like 2.57e-20
Family Pleckstrin-homology domain (PH domain) 0.0042
Further Details:      
 
Domain Number 4 Region: 861-970
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000011
Family Interleukin 16 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001986   Gene: ENSMPUG00000002005   Transcript: ENSMPUT00000002027
Sequence length 1685
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897165.1:1455590:1564367:1 gene:ENSMPUG00000002005 transcript:ENSMPUT00000002027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLSLRAQTRLQVTMGNSESQYTLPGSKNHSSSNTGAEQKPCSLKIRSVHGRDDKSLHGWG
HGGSGAGYKSRSLARSCLSHFKSAQPYASRLGGPTCKVPKSSAYPKPRTSGAGNEFQSGS
AAFSAENGFHDVGHERAADLAVSRDCSGHLLNCYGRSESAAATPPGEDRRSPRVLIKTLG
KLDGCLRVEFHSGGQQGRGSRGDAGGPVRLLRYSPTLGAGPDSPPDSRPRSSKGSSLSSE
SSWYDSPWGPVGEASEASEAEGSLPVPGTPAPGLCAADFPPPGAPKPFNQSSSLSSLREL
YPDPSPAPSGLRLSNEFMGTPASLSHRVSFASDMDVPSRVERRDPGPYSSFTLPCRKSKT
LTEDASKKDTLKARMRRISDWTGSLSRKKRKLQEPRSKEGSDYFDSRSDGLNVDVQGPFQ
MSASLWSGGSAQILSQRSESAHAIGSDSLQQNIYENFMRELEMSRTSTEHVETSTETADS
SSGSLSSLEQLDLLFEKEQGVVRKAGWLFFKPLVTLQKEKKLELVARRKWKQYWVTLKGC
TLLFYETYGKNSMDQSSAPRCALFAEDSIVQSVPEHPKKENVFCLSNSFGDVYLFQASSQ
TDLENWVTAIHSACASLFAKKHGKEDTVRLLKNQTRNLIQKIDMDSKMKKMAELQLSIVS
DPKNRKAIENQIQQWEQNLEKFHMDLFRMRCYLASLQGGELPNPKSLLAAASRPSKLALG
RLGILSVSSFHALVCSRDDSALRKRTLSLTQRGRNKKGLFSSLKGLDTLARKGKEKRPSV
PQVDDLLHIYGSAADGVPRDNTWEVQTYVHFQDNQGVTIMIKPEHRVEDILTLACKVIQG
SVNHYGLQLRKLVDENMEYCVPALYEFMQEQVYDEIEIFPLNVYSVDLHSTFLVTGFAVT
AQVDEHQHLSRILISDVLPDGLAYGEGLRKGNEIMTLNGEAVSHLDLKQMEALFSEQSVG
LTLIARPPETKGTLCSSWSDSDLFSRDQKHLLPPPNQSQLLEEFLDNFKKNTTNDFSNVP
DVTTGLKRSQTDGALAQVPHGEKTGQTFGSAEQIATLCRSFSDAQSDGMEGPRGTRDPPP
RPLARHLSDADRLRKVIQELMDTEKSYVKDLSCLFELYLEPLQNETFLTQDEMESLFGSL
PEMLEFQKVFLETLEDGISASSDFNSLETPSQFRKLLFSLGGSFLYYADHFKLYSGFCAN
HIKVQKVLERAKTDKAFKAFLDARNPTKQHSSTLESYLIKPVQRVLKYPLLLKELVSLTD
HESEEHYHLTEALKAMEKVASHINEMQKIYEDYGTVFDQLVAEQSGTEKEVTELSMGELL
MHSAVSWLNPFLSLGKARKDLELTVFVFKRAVILVYKENCKLKKKLPSNSRPAHNSADLD
PFKFRWLIPISALQVRLGNTAGTENNSVWELIHTKSEIEGRPETVFQLCCSDSESKTNIV
KVIRSILRENFRRHIKCELPLEKTCKDRLVPLKNRVPVSAKLASSRSLKVLKNSSSSEWP
GEPGKGSSSLDSDEGSLSSGTQSSGCPLGGSRQDSLQQPQPGLADLSDSLIKESDILSDD
EDDYHQTLQQGSPTKDIEIQFQRLRISDAPDAKPAEQPGTEGRPKGEQPKLVRGHFCAIK
RKANSTKRDRGALLKAQIRHQSLDSQSENANLDLGSVLQREFSVQSLTSVVNEECFYETE
GHGQL
Download sequence
Identical sequences M3XSD6
ENSMPUP00000001986 ENSMPUP00000001986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]