SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001993 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001993
Domain Number 1 Region: 18-139
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000939
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001993   Gene: ENSMPUG00000002013   Transcript: ENSMPUT00000002035
Sequence length 455
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896997.1:894382:919475:-1 gene:ENSMPUG00000002013 transcript:ENSMPUT00000002035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPRPQKSPGKPLAFYYENEVCKQDYFIKSPPPQLFFSASSWKRRYFILSKSGERSLRLS
YYKDQHRRGSIEIDRNSSVEVGIHGQEKMQSVQKMFKCLPDEVMSIRTTNREYFLIGQDR
EKIKDWVSFVSSFCLGGETARHSPQEKFSLGGKRPSSDPSPLLGSPSTSEAVGPTTPRNS
LPDMHLMEKNSPGLRQAHLLHDFLSETTEDTEEESYYVSPRSILSELNTFIASNDSGESA
EADSLNHFSETTENHYMSMKSCVFRETSHKTADSNKESQALPEIQNGGLHLQEQDSQSDS
CLPPANMEAQTVNDIKGNIPDEGQVEKLNVFLSPSDIINYLTLTEAAGQICVAQWQGPPR
LGCLFFHGDHLLAVNDLKPHGLDEASLFLSRSVQKEKIKLTIGRIPNSEKFHADSCTCSL
KNEHGVPYPLDKSGPGKTLKRSPAIRKGQCKGSGE
Download sequence
Identical sequences M3XSE3
ENSMPUP00000001993 XP_004763886.1.14098 ENSMPUP00000001993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]