SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001996 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001996
Domain Number 1 Region: 58-301
Classification Level Classification E-value
Superfamily Caspase-like 2.54e-94
Family Caspase catalytic domain 0.000000000494
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001996   Gene: ENSMPUG00000002017   Transcript: ENSMPUT00000002039
Sequence length 301
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896997.1:933011:958574:-1 gene:ENSMPUG00000002017 transcript:ENSMPUT00000002039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADDQGCGVEQAAGDTGSPDAVDAKPDRSSFVPSLFSKKKKNDPGKSIKTAQERVPTYQY
NMNFEKVGKCIIINNKNFDKRTGMGVRNGTDKDAEALFKCFRNLGFDVVVHNDCSCAKMQ
DLLKQASEEDHRNSACFACILLSHGEENLIYGTDGVTAIKDLTAHFRGDRCRSLLEKPKL
FFIQACRGTELDDGVQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRNPGSGSW
FVQALCSTLNEHGKSLEILHILTRVNNRVARHFESQSDDPHFHEKKQIPCVVSMLTKELY
F
Download sequence
Identical sequences M3XSE6
ENSMPUP00000001996 XP_004763887.1.14098 ENSMPUP00000001996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]