SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002021 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002021
Domain Number 1 Region: 132-207
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000000736
Family PDZ domain 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002021   Gene: ENSMPUG00000002042   Transcript: ENSMPUT00000002064
Sequence length 252
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896936.1:3780902:3801251:-1 gene:ENSMPUG00000002042 transcript:ENSMPUT00000002064 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEGENRPSEGSPQAGVVTVSDVQELIRRKEEIEAQIKANYEVLESQKGVGMNEPLVDCE
DYPRSDVDLYQVRTARHNIACLQNDHKAIMKQVEEALHQLHARDKEKQARDMAEAHKEAM
SRSLGQSEGLSQPQAFAKVNSVSPGSPASTAGLQVDDEIVEFGSVNTQNFQSLHNVGSVV
QHSEGKPLNVTVIRRGEKHQLRLVPTRWAGKGLLGISTYSSSEITDDVPWGTVVGKHLPL
PWTWVWLGISSF
Download sequence
Identical sequences M3XSH1
ENSMPUP00000002021 ENSMPUP00000002021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]