SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002033 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002033
Domain Number 1 Region: 1110-1246,1336-1622
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.01e-109
Family Myotubularin-like phosphatases 0.00000575
Further Details:      
 
Domain Number 2 Region: 1727-1887
Classification Level Classification E-value
Superfamily PH domain-like 1.13e-27
Family Pleckstrin-homology domain (PH domain) 0.00000224
Further Details:      
 
Domain Number 3 Region: 879-1020
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000922
Family GRAM domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002033   Gene: ENSMPUG00000002054   Transcript: ENSMPUT00000002076
Sequence length 1890
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897110.1:286134:306118:1 gene:ENSMPUG00000002054 transcript:ENSMPUT00000002076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GRLPDYLFLSSGSGEGQGQILQRFPEKDWEDNPFPQGIELFCQPSGWQLCPERNPPTFFV
AVLTDINSERHYCACLTFWEPAEPTQEAVCTEDATEREEDVDEGGPAQLSPATPGPPGQL
FAPKTLVLVSRLDHAEVFRNSLGLIYTIHVEGLNVGLENVIGNLLTCVIPLAGGSQRTIS
LGAGDRQVIQTPLADSLPVSRCSVALLFRQLGITNVLSLFCAALTEHKVLFLSRSYQRLS
DACRGLLALLFPLRYSFTYVPILPAQLLEVLSTPTPFIIGVNAAFQAETQELLDVIIADL
DGGTVTVPECVHVPPLPEPLQSQTHSVLSMVLDPELELADLAFPPPSTNASSLKMQDKEL
RAVFLRLFAQLLQGYRWCLHMVRIHPEPVIRFHKAAFLGQRGLVEDDFLMKVLEGMAFAG
FVSERGVPYRATDLFDELVAHEVARMRADENHPQRVLRHVRELAEQLYKNENPYPAVAMH
KVQRPGEASHLRRAPRPFPRLDDGMVQWIVDQATAKMQGAPPAVKAERRTTVPSGPPMTA
ILERSSGLHGNSARRLEVVRNCISYVFEGKMLEAKKLLPAVLRALKGRAARRCLTQELHL
HVQQNRAVLDHQQFDFVVRMMNCCLQDCTSLDEHGIAAALLPLVTAFCRKLSPGVTQFAY
SCVQEHVVWSTPQFWEAMFYGDVQTHIRALYLEPAEDRDHVQQVGDVSVPEDERSALDVA
SEQRRLWPTLSREKQQELVQKEESTVFSQAIHYANRMSYLLLPLDSSRSRLLRERAGLGD
LESASNSLVTNSMAGSVAESYDTESGFEDAETCDVAGAVVRFINRFVDKVCTESGVTSDH
LKGLHVMVPDIVQMHIETLEAVHRESKRLPPIQKPKLLRPRLLPGEECVLDGLRVYLLPD
GREEGAGGSGGGPALLPAEGAVFLTTYRVIFTGMPTDPLVGEQVVVRSFPVAALTKEKRI
SVQTPVDQLLQDGLQLRSCTFQLLKMAFDEEVGSDSAELFRKQLHKLRYPPDIRGTFAFS
LGSTHTPGRPPRATKDKGPSLKTLSRNLVKNAKKTIGRQYVTRKKYSPPSWEHRGQPPPE
DQEDEISVSEELEPSTLTPSSALKPSDRMTMSSLVERACCRDYQRLGLGTLSSSLSRAKS
EPFRISPVNRMYAICRSYPGLLIVPQSVQDNALQRVSRCYRQNRFPVVCWRSGRSKAVLL
RSGGLHGKGVVGLFKAQNAPSPGQSQADSSSLEQEKYLQAVVSSMPRFADASGRNTLSGF
SSAHVGSHAVPPVPSPRARVTTLSNPMAASASRRTAPRGKWSSVRASGRSGGLGVDVGSR
LAGRDMLSPPQANGAPPDPGFLQPQRAALYIIGDKAQLKGVRPDPLQQWELVPIEVFEAR
QVKASFKKLLKACVPGCPAAEPGPASFLRSLEDSEWLIQIHKLLQVSVLVVELLDSGSSV
LVSLEDGWDITTQVVSLVQLLSDPFYRTLEGFRLLVEKEWLSFGHRFSHRGAHTLAGQSS
GFTPVFLQFLDCVHQVHLQFPMEFEFSPFYLKFLGYHHASRRFRTFLLDSDYERIELGLL
YEEKGERRGQQACRSVWEYVDRLSKRTPVFYNYMYAPEDAEVLRPYSNVSNLKVWDFYTE
ETLAEGPPYDWELAQGPPEPPEEERPDGGAPQSRRRVVWPCYDSRPRAQPDAISRLLEEL
QRLETELGRPPERWKDTWDRVKAAQRLEARADGRGTPSSLLVSSVPHHRRSLGVYLQEGP
VGSTLSLSLDSDQSSGSTASSSRQAARRSTSTLYSQFQTAESENRSYEGTLYKKGAFMKP
WKARWFVLDKTKHQLRYYDHRVDTECKGVIDLAEVEAVAPGTPTMGAPKTVDEKAFFDVK
TTRRVYNFCAQDVPSAQQWVDQIQSCLSDA
Download sequence
Identical sequences M3XSI3
ENSMPUP00000002033 ENSMPUP00000002033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]