SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002035 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002035
Domain Number 1 Region: 6-144
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.08e-39
Family Gelsolin-like 0.00000845
Further Details:      
 
Domain Number 2 Region: 385-521
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 2.08e-38
Family Gelsolin-like 0.0000406
Further Details:      
 
Domain Number 3 Region: 241-433
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 3.4e-36
Family C-terminal, gelsolin-like domain of Sec23/24 0.012
Further Details:      
 
Domain Number 4 Region: 613-728
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.43e-34
Family Gelsolin-like 0.0000264
Further Details:      
 
Domain Number 5 Region: 506-606
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 2.8e-25
Family Gelsolin-like 0.00044
Further Details:      
 
Domain Number 6 Region: 740-816
Classification Level Classification E-value
Superfamily VHP, Villin headpiece domain 8.11e-23
Family VHP, Villin headpiece domain 0.00023
Further Details:      
 
Domain Number 7 Region: 121-230
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 1.73e-22
Family C-terminal, gelsolin-like domain of Sec23/24 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002035   Gene: ENSMPUG00000002056   Transcript: ENSMPUT00000002078
Sequence length 816
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897076.1:2040627:2061400:-1 gene:ENSMPUG00000002056 transcript:ENSMPUT00000002078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLSSAFRAVGNEPGIITWRIEKLELALVPLSAHGNFYEGDCYVILSTRRVGSLLSQDIH
FWIGKDSSQDEQACAAIYTTQLDDYLGGSPVQHREVQYHESDTFHGYFKQGIIYKKGGVS
SGMKHVETNTYDVKRLLHVKGKRNIRATEVDMSWDSFNQGDVFLLDLGKVIIQWNGPESN
SGERLKAMLLAKDIRDRERGGRAEIGVIEGDKEAASPELMKVLQDTLGRRSVIKPAVPDE
IIDQQQKSNIMLYHVSDSAGQLAVTEVATRPLVQDLLNHDDCYILDQCGTKIYVWKGRGA
TKTEKQTAMSKALHFIQMKGYPSSTNVETINDGAESAMFKQLFQKWSGKDQTVGLGKTFG
VGKIAKVFQDKFDVTLLHTKPEVAAQERMVDDGNGKVEVWRIENLELVPVEHQWYGFFYG
GDCYLVLYTYKIHGKPHYILYIWQGRHASKDEVTASAYQAVEVDQQFDGAPVQVRVAMGK
EPRHFMAIFKGKLVIFEGGTSRKGNAEPDPPVRLFQIQGNDKSNTKAVEVPAFASSLNSN
DVFLLQTQAEHYLWYGKGSSGDERAMAKELASLLCERTEDAVAEGQEPPEFWDLLGGKTA
YANDKRLQQEILDVQPRLFECSNKTGRFVVTEITDFTQDDLNPGDVMLLDTWDQVFLWIG
AEANATEKEKALATAQEYLHTHPSGRDADTPILIIKQGFEPPIFTGWFLAWDPHVWSAGK
SYEQLKEELGDAAAITRITADMRNATLSLNCEPKYYPLEVLLKNQNQELPEDVNPAKKEN
YLSEQDFISVFGITRGQFAALPGWKQLQMKKEKGLF
Download sequence
Identical sequences M3XSI5
ENSMPUP00000002035 ENSMPUP00000002035 XP_004773332.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]