SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002074 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002074
Domain Number 1 Region: 132-208
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000288
Family HLH, helix-loop-helix DNA-binding domain 0.0000374
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002074   Gene: ENSMPUG00000002095   Transcript: ENSMPUT00000002117
Sequence length 291
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896997.1:3880356:3960262:-1 gene:ENSMPUG00000002095 transcript:ENSMPUT00000002117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKRGRPRKEARCEGAGLAPAAPPAVAAPQPPAQPEEPAGAKLRCPFSDIFNTSENSMEK
HINTFLQNVQILLEAASYLEQIEKENKKCEHGYASTFPSMPSPRLQHSKPPRRLSRAQKH
SNGSSNTSIANRSTHNELEKNRRAHLRLCLERLKVLIPLGPDCTRHTTLGLLNKAKAHIK
KLEEAERKSQHQLENLEREQRFLKRRLEQLQGPQEMERIRMDSIGSTVSSDRSDSEREEI
EVDVESTEFSHGEVDNISTTSISDIDDHSSLQSIGSDEGYSSASVKLSFTS
Download sequence
Identical sequences M3XSM4
ENSMPUP00000002074 ENSMPUP00000002074 XP_004763930.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]