SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002080 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002080
Domain Number 1 Region: 10-88
Classification Level Classification E-value
Superfamily PDZ domain-like 1.03e-19
Family PDZ domain 0.0000762
Further Details:      
 
Domain Number 2 Region: 514-578
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.81e-17
Family LIM domain 0.023
Further Details:      
 
Domain Number 3 Region: 455-517
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.93e-16
Family LIM domain 0.0018
Further Details:      
 
Domain Number 4 Region: 422-453
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000236
Family LIM domain 0.001
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000002080
Domain Number - Region: 573-601
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00159
Family LIM domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002080   Gene: ENSMPUG00000002101   Transcript: ENSMPUT00000002123
Sequence length 605
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896950.1:3854954:4057865:-1 gene:ENSMPUG00000002101 transcript:ENSMPUT00000002123 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNYSVSLVGPAPWGFRLQGGKDFNMPLTISSLKDGGKASQANVRIGDVVLSIDGISAHG
MTHLEAQNKIKGCTGSLNMTLQRASATPKPEPVAVQKKTQVTNNPGTVRTPPKRPPRKHI
VERNTEFYHIPTHSDASKKRLIEDTEDWRPRTGTTQSRSFRILAQITGTEHLKESDTENT
KKAKFDSSLEDLPQSGPHPPATPQVLHIGSQVATLSKVTACSSLSRSTRNLVTRSLEGFR
NFSTFSSPARYSAAVLSSAAATVSAALAAKTRLSSPDKYHSLLDALCISPVSKPLAFSYL
QSSRKSTGSIHVKKISNTQETSQQLSPSVASARSMPERRESPASTRPGMAGLTTAAAFKP
PGSANIVKSPSWPHPNQAALSTGRISNSATSSGAVAPASSAGGQPQPGDQDTFVQRAEHI
PAGKRTPMCAHCNQVIRGPFLVALGKSWHPEEFNCAHCKNTMAYIGFVEEKGALYCELCY
EKFFAPECGRCQRKILGEVINALKQTWHVSCFVCVACGKPIRNNVFHLEDGEPYCETDYY
ALFGTICHGCEFPIEAGDMFLEALGYTWHDTCFVCSVCCESLEGQTFFSKKDKPLCKKHA
HSVNF
Download sequence
Identical sequences M3XSN0
ENSMPUP00000002080 ENSMPUP00000002080 XP_012913482.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]