SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002094 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002094
Domain Number 1 Region: 51-130
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000117
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.006
Further Details:      
 
Domain Number 2 Region: 322-369
Classification Level Classification E-value
Superfamily RING/U-box 0.000000118
Family RING finger domain, C3HC4 0.018
Further Details:      
 
Domain Number 3 Region: 266-302
Classification Level Classification E-value
Superfamily SAP domain 0.0000153
Family SAP domain 0.0073
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000002094
Domain Number - Region: 220-244
Classification Level Classification E-value
Superfamily ARM repeat 0.0691
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002094   Gene: ENSMPUG00000002115   Transcript: ENSMPUT00000002137
Sequence length 375
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896936.1:4149961:4172069:-1 gene:ENSMPUG00000002115 transcript:ENSMPUT00000002137 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAGATSMWASCCGLLNEVMGTGAVRGQQSGFAGGTGPFRFAPNSDFSAYPPAPTEGPNI
VCKACGLSFSVFRKKHVCCDCKKDFCSVCSVLQENLRRCSTCHLLQETAFQRPQLMRLKV
KDLRQYLILRNIPIDTCREKEDLVDLVLCHHGLGSEDDLDTSSLNSSRSQTSSFFTHSFF
SNYTAPSATMSSFQGDLMGGDRTLGSGALAQVQSEIASANTEEEDEEDEDEDDEEDEDEE
NLEEQTPGLSKKRVRASLSDLSSLEDVEGMSVRQLKEILARNFVNYSGCCEKWELVEKVN
RLYKENEENQKSYGERLQLQDEEDDRLCRICMDAVIDCVLLECGHMVTCTKCGKRMSECP
ICRQYVVRAVHVFKS
Download sequence
Identical sequences M3XSP4
XP_004753265.1.14098 ENSMPUP00000002094 ENSMPUP00000002094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]