SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002103 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000002103
Domain Number - Region: 1100-1197
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000151
Family PLC-like (P variant) 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002103   Gene: ENSMPUG00000002124   Transcript: ENSMPUT00000002146
Sequence length 1621
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897079.1:1433114:1569280:1 gene:ENSMPUG00000002124 transcript:ENSMPUT00000002146 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPKEEKVKIITEEFIENDEDTGVGRQKKTSKTARQKRKKQLPTAGGPEEMVSENPHLGD
QQEPMQEDSDTRPLSITSRRGPRSLPPIPSASRTGFAEFSMRERMREKLQAARSKAESTL
LQEIPTPRPRRLQSPNKRELETEFGTEAGEEVQRTQQDDFQSYSRVKFRDSVQKIKPKLP
VPPGFPSAEEAYNFFTFNFDPEPEESQEKPKAKTRAGTNQEEEEGEEEEPPAQGERRTDE
EELLSAKDEEDFLLGLDHAAEDFIAVRPAEYESVHVRLQMERELLFVPSRVTVPTYKKLP
ENVQPRFLEDEGLYIGARPEVPRTCQNTMENRLLTQEPGRKWFGDDGRILALPNPTKAFP
SRPPVLTQAQDIKAELETLYKKAVKYVHRSQHMIGSGDPPGNFQLDIDISGLIFTHHPCF
SREHVLAAKLAQLYDQYLARQQRNKAKFLTDKLQALRNAVQTGMNPAKPHKSLDTTQKAI
NEYKSEIRQTRKLRDTEQEKDRTLLKTIIKVWKEMKSLREFQRFTNTPLKLVLRKEKVDR
EADEAAYEAEIQAEISELLEEHREEYEQKMEAYRAAYQQWKAWKKAQRAKKKKKKQEHPV
EEHPDEGLEEPYPGEEPVKPVPPEPTDQALVEQQVRERAARSRRRPGEPTLVPELSLAGS
ITPNEQCPRVEVLRREDVKRRSIYIKVIFNDKEVSRTDSRPLGADFRVHFGQIFNLQIFN
WPESLTLQVYETVGHTGTTLLAEVFLPIPETTVVTGRAPIEEVEFSSNQHVTLDHEGVGS
GVPFSFEADGSNQLILMTSGKVSNSVAWAIGENGIPLIPPLSQQNIGFRSALKRADAISS
IGTSGLTDLKKLAKWAAESKLDPNDPNNAPLMQLISVATSGESYVPDFFRLEQLQQEFNF
VSDEELNRSKRFRLLCLRSQEVPEFRNYKQIPAYDREILEKVFQDYEKRLRDRNIIETKD
HIDTHRAIVAKYLQQVRESVINRFLIAKHHFLLSDLVVEEEVPNISILGLSLFKLAEQKR
PLRPRRKGRKKVTAQNLSDGDIKVLVNIIRAYDIPVRKPTASKFQQPSRSSRTFSEKRAA
SPTTHSPTHSVDYPLGQVLVRPFVEVSFQRTICHTTTAEGPNPSWNEELELPFRAPNGDY
STTSLQSVKDDVFINIFDEVLYDVLEDDRERGSGIHTRIERHWLGSVKIPFSTIYFQAKI
DGTFKIDIPPVLLGYSKERSLIIERGFDSVRSLSEGSYITLFITIEPQLVPGESVREKFD
SQEDEKLLQATEKFQTECALKFPHRQCLTTVTDISGKTVFVTRYLKPLNPPQELLDACPN
SPQATAELVARYVSLIPFLPDTVSFASICDLWSTSDQFLDLLAGDEEEHAVLLCNYFLSL
GKKAWLMMGSAIPEGPTAYVLTREQSHYLIWNPCTGHFYGQFDTFCPLKSVGCLIGPDNI
WFNIQRYDSPLRINFDVTKPKLWKSFFSRSLPYPGLSSVQPEELIYQRTDKAAAAELQDR
IEKILKEKIMDWRPRHLTRWNRYCTSALRHFLPVLERSRGEDVEDDHRAELLKQLGDYRF
SGFPLHMPYSELKPLIEAVYSTGVHNIDVPNVEFALAVYIHPYPKNVLSVWIYVASLIRN
R
Download sequence
Identical sequences M3XSQ3
ENSMPUP00000002103 XP_004773435.1.14098 ENSMPUP00000002103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]