SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002120 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002120
Domain Number 1 Region: 70-180
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000439
Family PDZ domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002120   Gene: ENSMPUG00000002142   Transcript: ENSMPUT00000002164
Sequence length 710
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896944.1:83774:93026:1 gene:ENSMPUG00000002142 transcript:ENSMPUT00000002164 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRQLQPEEQEAETEDNPSVTEGPVDEIIRPRPQGSSPVYEYAAEGTSFGLPEDTPRRR
ASSGSGGLRSWWKRDSGDSRTFSRMSQPQSVQEATEVTLMTEAEAGASGYSVTGGGHQGI
FVKQVLKDSPAAKLFSLREGDQLLSATVFFDNIKYEDALKILQYSEPYRVQFQVRRKRPA
PDDEDVAAGGTQPGPKDREKQDKDVADGSTETPPQTLEGSGDQERLLAKPREGRGRRAQK
ERLSWPKFQSITSKRRPGPRRSHSSSEADGRGNAPNVSPTSTDTEAPRPAEEREPKAGPD
SPRRKRFLTLRFRMGSGKGPTLEGRPSGGGPGGALQTGGVEEAGPTEERQQAAEATVLSR
REDWKAEGPEGTPALTAELPIEPGAPALGALRGGASMVSGGRKETKEAKEREAAVAEGRP
GASSPAHGLDRRSQGARGPEVGMAGSAGPGEGDARGLHTDIHIQIPNLQTPRFTVSKEKK
HDPEGGLAPGPEDRRRRTPGIPEQGAEPAAPRKPSGHQPQGEIGRAEGAEAGHRIAHVKD
GDNDKGKRDSRRTVLKFNVSSFAWSSRKEVRAAWEPPWEELDQERGGTLREWTLQTEEKD
TLREKQEEKIPTEEGQPSARETQRQKKGEVTPGDKEVATRDSKFKMPKFKMPSFGASAPS
KSLEASVDASLPKVQAEVSVPSVQADVKAGXXXXXXXXXXXXXXXXXXXX
Download sequence
Identical sequences M3XSS0
ENSMPUP00000002120 ENSMPUP00000002120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]