SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002136 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002136
Domain Number 1 Region: 145-456
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.07e-99
Family Protein kinases, catalytic subunit 0.0000000000539
Further Details:      
 
Domain Number 2 Region: 1-113
Classification Level Classification E-value
Superfamily PH domain-like 2.18e-24
Family Pleckstrin-homology domain (PH domain) 0.000000837
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002136   Gene: ENSMPUG00000002158   Transcript: ENSMPUT00000002180
Sequence length 480
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896944.1:200022:216379:1 gene:ENSMPUG00000002158 transcript:ENSMPUT00000002180 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKSDGSFTGYKERPQDVEQREAPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKRQEEEMMDF
RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFPEDRARFYGAEIVSALHYLHSEKNVVYRDLKLENLMLDKDGHVKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMLCGRLPFYNQDHEKLFEL
ILMEELRFPRTLSPEAKSLLSGLLRKDPKQRLGGGPEDATEIMQHRFFASIVWQDVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQGDTMEGEDSERRPHFPQFSYSASGTA
Download sequence
Identical sequences M3XST6
ENSMPUP00000002136 ENSMPUP00000002136 XP_004754638.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]