SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002151 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002151
Domain Number 1 Region: 185-327
Classification Level Classification E-value
Superfamily PH domain-like 1.66e-39
Family Third domain of FERM 0.00041
Further Details:      
 
Domain Number 2 Region: 85-187
Classification Level Classification E-value
Superfamily Second domain of FERM 4.84e-27
Family Second domain of FERM 0.00015
Further Details:      
 
Domain Number 3 Region: 3-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.3e-22
Family First domain of FERM 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002151   Gene: ENSMPUG00000002173   Transcript: ENSMPUT00000002195
Sequence length 710
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897183.1:1357007:1403831:-1 gene:ENSMPUG00000002173 transcript:ENSMPUT00000002195 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHLKVQFLDDSQKIFVVDQKSSGKALFNLSCSHLNLAEKEYFGLEFCSHSGNNVWLELL
KPITKQVKNPKEVVFKFMVKFFPVDPGHLREELTRYLFTLQIKKDLALGRLPCSENCTAL
MVSHILQSELGDFHEETDKKHLAQTRYLPNQDCLESKIVHFHQKHVGRSPAESDILLLDV
ARKLDMYGIRPHPASDGEGTQIHLAVAHMGVLVLRGNTKINTFNWAKIRKLSFKRKHFLI
KLHANILVLCKDTLEFTMASRDACKAFWKTCVEYHAFFRLSEEPKSKPKTLLCSKGSSFR
YSGRTQRQLLEYGKKGRLTSLPFERKHYPSEYHERQCRSSPDLLSDVSKQVEDLRLAYGG
GYYRNVNGGHASEPVLDGRRRNSAVEVTFAAELERSKPEADPTLLHQSQSSSSFPFIYTD
PVFSTDPDPRDYFEERSPLSSFQPSCKFADKHMSTSSGLASKVSPAKQLTYTDVPYIPCT
GQQVDIMPPQVFFYVDRPPQVPRRSPVMAEERERPDSCLEPTAMKPAKRSPRNVRMKSFQ
QDFQELQEAMARTSGRSNINVDLEAEDPNLEDAFAYSIQDQTPKRSQSQSDMKTMRFPFG
SEFRPLGPCPTLSRKTDLFTYMFAEQEFPTVLMDEGAAERYIASESSDSESEILKPGYYS
LYGKGIRSPMARIRLSSGSLQLDEEDEGVSFNTPTAEDRTLLKPCNYFLA
Download sequence
Identical sequences M3XSV1
XP_004778778.1.14098 ENSMPUP00000002151 ENSMPUP00000002151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]