SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002174 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002174
Domain Number 1 Region: 6-291
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.46e-81
Family Protein kinases, catalytic subunit 0.000000000223
Further Details:      
 
Domain Number 2 Region: 369-663
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.27e-79
Family Ankyrin repeat 0.0000129
Further Details:      
 
Domain Number 3 Region: 1302-1392
Classification Level Classification E-value
Superfamily DEATH domain 4.42e-19
Family DEATH domain, DD 0.0034
Further Details:      
 
Domain Number 4 Region: 673-709,785-893
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000682
Family G proteins 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002174   Gene: ENSMPUG00000002196   Transcript: ENSMPUT00000002218
Sequence length 1430
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897087.1:3625512:3796387:1 gene:ENSMPUG00000002196 transcript:ENSMPUT00000002218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVFRQENVDDYYDTGEELGSGQFAVVKKCREKSTGVQYAAKFIKKRRTKSSRRGVSRED
IEREVSILKEIQHPNIITLHEVYENKTDVILILELVAGGELFDFLAEKESLTEEEATEFL
KQILNGVYYLHSLQIAHFDLKPENIMLLDRNVPKPRIKIIDFGLAHKIDFGNEFKNIFGT
PEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANVSAVNYEFEEEY
FSNTSALAKDFIRRLLVKDPKKRMTIQDSLQHPWIKPKDTQQALSRKASAVNMEKFKKFA
ARKKWKQSVRLISLCQRLSRSFLSRSNMSVARSDDILDEEDSFVMKAIIHAINDDNVPGL
QHLLGSLSNYDVNQPNKHGTPPLLIAAGCGNIQILQLLIKRGSRIDVQDKGGSNAIYWAS
RHGHVDTLKFLNENKCPLDVKDKSGETALHVAARYGHADVVQLLCSFGSNPNFQDKEEET
PLHCAAWHGYYSVARALCEAGCNVNIKNREGETPLLTASARGYHDIVECLSEHGADLNAS
DKDGHIALHLAVRRCQVEVIQTLIGQGCSVDFQDRHGNTPLHVACKDGNMPIVVALCEAG
CNLDISNKYGRTPLHLAANNGILDVVRYLCLAGANVEALTSDGKTAEELAKSEQHEHVAG
LLARLRKDAHRGLFIQQLRPTQNLQSRIKLKLFGHSGSGKTTLVESLKCGLLRSFFRRRR
PRLSSASSTRFPPSPLASKPAVSVSISNLYPGCEHVSVRSRSMMFEPGLTRGTLEVLVAP
PQHPHCAADDQSTKAIDIQNAYLNGVGDFSVWEFSGNPVYFCCYDYFAANDPTSIHVIVF
SLEEPYEIQLNQVIFWLNFLKSLVPVEEPIAFGGKLKNPLHVVLVATHADIMNVPRPAGG
EFGYDKDTSLLKEIRNRFGNDLHISNKLFVLDAGASGSKDMKVLRSHLQDIRSQIVSVCP
PMTHLCEKIISTLPSWRKLNGPNQLMSLQQFVYDVQDQLNPLAREGDLRRIAQQLHSAGE
INIMQSETVQDVLLLDPRWLCTNVLGKLLSVETPRALHHYRGRYTVEDVQRLVPDSDVEE
LLQILDAMDICARDLSSGTMVDIPALIKTDNLHRSWTDEEDEGRVYGGVRIVPVEYLTPF
PCGIFHKVQVNLCRWIHQQSAEGDADIRLWVNGCKIANRGAELLVLLVNHGQGIEVQVRG
LETEKIKCCLLLDSVCSTMENVMATTLPGLLTVKHYLSPQQLREHHEPVMIYQPRDFFRA
QTLKETSLTNTMGGYKESFSSIMCFGCHDVYSQASLGMDIHASDLNLLTRRKLCRLLDPP
DPMGKDWCLLAMNLGLPDLVAKYNTNNGAPKEFLPSPVHALLQEWTSYPESTVGILMSKL
RELGRRDAADFLLKASSVFKINLDGNGQEAYDSSCNSGTSYNSISSVVSR
Download sequence
Identical sequences M3XSX4
XP_012902075.1.14098 ENSMPUP00000002174 ENSMPUP00000002174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]