SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002184 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002184
Domain Number 1 Region: 528-897
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 4.71e-127
Family Hect, E3 ligase catalytic domain 0.00000000368
Further Details:      
 
Domain Number 2 Region: 20-157
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 9.82e-30
Family Synaptotagmin-like (S variant) 0.039
Further Details:      
 
Domain Number 3 Region: 473-513
Classification Level Classification E-value
Superfamily WW domain 0.0000000000000306
Family WW domain 0.00011
Further Details:      
 
Domain Number 4 Region: 182-225
Classification Level Classification E-value
Superfamily WW domain 0.000000000000181
Family WW domain 0.0011
Further Details:      
 
Domain Number 5 Region: 342-382
Classification Level Classification E-value
Superfamily WW domain 0.000000000000695
Family WW domain 0.0018
Further Details:      
 
Domain Number 6 Region: 421-457
Classification Level Classification E-value
Superfamily WW domain 0.00000000000236
Family WW domain 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002184   Gene: ENSMPUG00000002206   Transcript: ENSMPUT00000002228
Sequence length 904
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897192.1:782902:908065:1 gene:ENSMPUG00000002206 transcript:ENSMPUT00000002228 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATCAVEVFGLPEDEENSRIVRVKVIAGIGLAKKDILGASDPYVRVTLYDPMNGVFTSVQ
TKTIKKTLNPKWNEEILFRVHPQQHRLLFEVFDENRLTRDDFLGQVDVPLYPLPTENPRM
ERPYTFKDFVLHPRSHKSRVKGYLRLKMTYLPKTSGSEEDNTEQAEELEPGWVVLDQPDA
ACHLQQQQEPSPLPPGWEERQDILGRTYYVNHESRRTQWKRPTPQDNLTDAENGNMQLQA
QRAFTTRRQISEETESVDNRESSENWEIIREDEATMYSNQAFPSPPASNNLDVQTPLAEE
LNARLTICRNSATGQPVSSSNHSSRRGSLQAYTFEEQPTLPVLLPTSSGLPPGWEEKQDE
RGRSYYVDHNSRTTTWTKPMVQATAESSQLPSGQSSACPRPQVRPQVPPGDSAQQMTQPS
EMEQGFLPKGWEVRHAPNGRPFFIDHNTKTTTWEDPRLKIPPHLRGKTSLDSSNDLGPLP
PGWEERTHTDGRIFYINHNIKRTQWEDPRLQNVAITGPAVPYSRDYKRKYEFFRRKLKKQ
NDIPNKFEMKLRRATVLEDSYRRIMGVKRADFLKARLWIEFDGEKGLDYGGVAREWFFLI
SKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDGFF
IRPFYKMMLHKPITLHDMESVDSEYYNSLRWILENDPTELDLRFVIDEELFGQTHQHELK
IGGSEIVVTNKNKKEYIYLVIQWRFVNRIQKQMAAFKEGFFELIPQDLIKIFDENELELL
MCGLGDVDVNDWREHTKYKNGYSVNHQVIQWFWKAVLMMDSEKRIRLLQFVTGTSRVPMN
GFAELYGSNGPQSFTVEQWGTPEKLPRAHTCFNRLDLPPYESFEELWDKLQMAIENTQGF
DGVD
Download sequence
Identical sequences M3XSY4
XP_004779271.1.14098 ENSMPUP00000002184 ENSMPUP00000002184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]