SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002257 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002257
Domain Number 1 Region: 2174-2471
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.11e-97
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000000663
Further Details:      
 
Domain Number 2 Region: 665-773
Classification Level Classification E-value
Superfamily Second domain of FERM 4.45e-33
Family Second domain of FERM 0.00019
Further Details:      
 
Domain Number 3 Region: 1351-1455
Classification Level Classification E-value
Superfamily PDZ domain-like 6.7e-28
Family PDZ domain 0.0000199
Further Details:      
 
Domain Number 4 Region: 1074-1184
Classification Level Classification E-value
Superfamily PDZ domain-like 3.81e-27
Family PDZ domain 0.0074
Further Details:      
 
Domain Number 5 Region: 775-881
Classification Level Classification E-value
Superfamily PH domain-like 5.84e-27
Family Third domain of FERM 0.0023
Further Details:      
 
Domain Number 6 Region: 1784-1873
Classification Level Classification E-value
Superfamily PDZ domain-like 4.99e-22
Family PDZ domain 0.014
Further Details:      
 
Domain Number 7 Region: 1491-1596
Classification Level Classification E-value
Superfamily PDZ domain-like 1.84e-20
Family PDZ domain 0.034
Further Details:      
 
Domain Number 8 Region: 1876-1968
Classification Level Classification E-value
Superfamily PDZ domain-like 5.06e-18
Family PDZ domain 0.032
Further Details:      
 
Domain Number 9 Region: 571-664
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.92e-16
Family First domain of FERM 0.014
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000002257
Domain Number - Region: 2-154
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000421
Family Protein kinases, catalytic subunit 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002257   Gene: ENSMPUG00000002281   Transcript: ENSMPUT00000002303
Sequence length 2486
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896950.1:11340546:11495425:-1 gene:ENSMPUG00000002281 transcript:ENSMPUT00000002303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHVSLAEALEVRGGPLQEEEIWAVLNQSAESLQELFRKVSIADPAALGFIISPWSLLLLP
SGSVSFTDENISDQDLRAFTAPEVLQNQSLTSLSDVEKIHIYSLGMTLYWGADHEVPQSQ
PIKLGDHLNSILLGMCEDVIYARVSVRTVLDACSAHIRNSNCAPSFSYVKQLVKLVLGNL
SGTDQLSHNNEQKPDRSQAIRDRLRGKGLPTGRSTTSDVLDIHKSPFSQQTFLNKGLSKS
MGFLSIRDTQDEEDYFKDISSDNNSGHEDSENACSPYQFKTSGPEKKTLPGIDVLPKKKI
WASSMDLLCTADRDFSGETGGFRQYLPQAVTVRTSTTPRKKEARYSDGSIALDIFGPQKV
DPMLHMRELPTSSAISSALDRIRERQKKLHVLREAMNVEEPIRRYKTYHSDIFSTSSESP
SIISSESDFRQVRKSEASKRFESNSGLTGVDENLSQSQSQRPRQYETPLEGNVINQEIML
KRQEEEMMQLQARMALRQSRLSLYPGDTIKASMLDISRDPLREMALETAMTQRKLRNFFG
PEFVKMTIEPFISLDLPRSILAKKGKNEDNRRKVNIMLLSGQRLELTCDTKTICKDVFDM
VVAHIGLVEHHLFALATLKDNEYFFVDPDLKLTKVAPEGWKEEPKKKSKAAVNFTLFFRI
KFFMDDISLIQHTLTCHQYYLQLRKDILEERMHCDDETSLLLASLALQAEYGDYQPEVHG
MSYFRLEHYLPPRVMEKLDLSYVKEELPKLHNTYAGASEKETELEFLKVCQRLTEYGVHF
HRVHPEKKSQTGILLGVCSKGVLVFEVHNGIRTLVLRFPWRETKKISFSKKKITLQNTSD
GIKHAFQTDNSKVCQYLLHLCSSQHKFQLQMRARQSNQDAQDIERASFRSLNLQAESIRG
FNMGRAISTGSLASSTLNKLAVRPLSVQAEILKRLSCSELSLYQPLQNSAKEKSDKASWE
EKPRGMSKSYHDLSQASLYPHRKNVIVNMESPPQSIAELVGKPLHQMARSDTESLAGFTK
LNNSKSVASLNRSPERRKQESDSSSFEDPGQAYVIGMTLHSSGNSSSQVPLKENDVLHKR
WSIVSSPEREITLVNLKKDAKYGLGFQIIGGEKMGRLDLGVFISSVTPGGPADLDGCLKP
GDRLISVNSVSLEGVSHHAAIEILQKAPEDVTLVISQPKEKIPKVPSTPVHVANGMKNYM
KKPSYMQDSAIDSSEDHRWPQGTPRHVSESSFGLSGGLREGSLSSQDSRTESASLSQSQV
NGFFASPAGDRTWQETQRGSPSPSVISKTTEKKRTATDSNRGKTKKPGISDATDYSDRGD
SDMDEATYSSSQDHQTPKKESSSSMNTSNKMNFKTFPSSPPKPGDIFEVELAKNDNSLGI
SVTGGVNTSVRHGGIYVKAVIPKGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRN
TGQVVHLLLEKGQSPASKERVPLSPQCTLPDPDAQGQAPEKTKKMTHIKDYSFVTEENTF
EVKLFKNSSGLGFSFSREDSLIPEQMNASIVRVKKLFPGQPAAESGKIDVGDVILKVNGA
SLKGLSQQEVISALRGTSPEVSLLLCRPSPGVLPEIDPALLTPLHSPAQVLPNNTKDSSQ
PACVEQGTSSDENEIYDTSKKSCTSPSRRDSYSDSSGSGEEDLVKAPAKIPNMSWSSSLH
QTLNNMVSQAQSQHEASKSQEDTICTMFYYPQKTPNKPEGEDSNPPSPLPSDMTLGRSYQ
PQAESACTNSMDKYHIYHISEPARQENLTSLKNDLENHFEDFELEVELLITLIKSEKGSL
GFTVTKGNQSIGCYVHDVIQDPAKSDGRLRPGDRLIKVNDTDVTNMTHTDAVNLLRAAPK
TVRLVLGRVLELPRMPVLPHLLPDITLTCNKEELGFSLSGGHDSLHQVIYISDINPRSVA
AIEGNLQLLDIIHYVNGVSTQGMTLEEANRALDISLPSVVLKATRDGHPVVPSSKRSAFS
TQSTKANGHHPVESCCKPVLTPSNSFSKVNGEEITEVLYPEGKCSTYQMKGSANLILSKE
SNVPEDDIYDDPQEAEVIQSLLDVVDEEAQNLLNQNNAAGDACVPGSLKTNGKLSEERAE
DTDCDGSPLPEDFTESVKMNGCEEYGEEKVKSESLIQKSQERKPDDDDEITWGSDELPIE
TTNHEDSDKDHPFLTNEELAALPIVKVLPSGKYTGTKLKSVIRTLRGLLDQGIPSKELEN
LQELKPLDQCLIGQTKENRKKNRYKNILPYDATRVPLGDEGGYINASFIKIPVGKEEFVY
IACQGPLPTTVGDFWQMIWEQKSTVIAMMTQEVEGEKIKCQRYWPNILGQTTMVNDRLRL
ALVRMQQLKGFVVRAMALEEIQTGEIRHISHLNFTAWPDHDTPSQPDDLLTFISYMRHIH
RSGPIITHCSAGIGRSGTLICIDVVLGLISQDLEFDISDLVRCMRLQRHGMVQTEDQYIF
CYQVILYVLTRLQAEEEQKEQPQLLK
Download sequence
Identical sequences M3XT57
ENSMPUP00000002257 ENSMPUP00000002257 XP_012913522.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]