SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002271 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002271
Domain Number 1 Region: 36-234
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.28e-57
Family BCR-homology GTPase activation domain (BH-domain) 0.00011
Further Details:      
 
Domain Number 2 Region: 3-39
Classification Level Classification E-value
Superfamily PH domain-like 0.00000202
Family Pleckstrin-homology domain (PH domain) 0.0095
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000002271
Domain Number - Region: 542-641
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000398
Family FCH domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002271   Gene: ENSMPUG00000002295   Transcript: ENSMPUT00000002317
Sequence length 654
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896950.1:12147472:12367101:-1 gene:ENSMPUG00000002295 transcript:ENSMPUT00000002317 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTANHESYLLMASTQNDMEDWVKSIRRVIWGPFGGGIFGQKLEDTVRYEKRYGNRLAPML
VEQCVDFIRQRGLKEEGLFRLPGQANLVKELQDAFDCGEKPSFDSNTDVHTVASLLKLYL
RELPEPVIPYAKYEDFLACAKLLSKDEEAGVKELAKQVKSLPVVNYNLLKYICRFLDEVQ
SYSGVNKMSVQNLATVFGPNILRPKVEDPLTIMEGTVVVQQLMSVMIGKHDRLFPKEAEP
QSKPQDGVSNNNNEIQKKATMGQLQNKENNNTKDSPGRRCSWDKSESPQRSGMDNGSPTA
VPGSKTNSPRNSVHKLDVSRSPPLMVKKNPAFNKGSGIVTNGSFSSSNVEGLEKTQTTPN
GSLQARRTSSLKGSGTKMGTHSVQNGTVRMGILNPDTLGNPMNGRSMSWLPNGYVTLRDN
KQKEQAGESGQHNRLSTYDNVHQQFSMMNLDDKQSVDSATWSTSSCEISLPENSNSCRSS
TTTCPEQDFYGANFEDPVLDGPPQDDLSHPGDYENKSDRRSVGGRSSRATSSSDNSETFV
GNTTSNHSALHSLVSSLKQEMTKQKIEYESRIKSLEQRNLTLETEMMSLHDELDQERKKF
TMIEIKMRNAERAKEDAEKRNDMLQKEMEQFFSTFGELTVEPRRTERGNTIWIQ
Download sequence
Identical sequences M3XT71
XP_004756205.1.14098 XP_004756206.1.14098 XP_004756207.1.14098 ENSMPUP00000002271 ENSMPUP00000002271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]