SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002308 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002308
Domain Number 1 Region: 35-113
Classification Level Classification E-value
Superfamily SH3-domain 1.18e-17
Family SH3-domain 0.00079
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000002308
Domain Number - Region: 677-730
Classification Level Classification E-value
Superfamily SH3-domain 0.0922
Family SH3-domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002308   Gene: ENSMPUG00000002332   Transcript: ENSMPUT00000002354
Sequence length 962
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897148.1:828727:915042:1 gene:ENSMPUG00000002332 transcript:ENSMPUT00000002354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAQRIRAANSSGLPRCKSEGTLIDLSEGFSEASFNDVKVPSPSALLVDNPTPFGNAKEV
IAIKDYCPTNFTTLKFSKGDHLYVLDTSGGEWWYAHNTTEMGYIPSSYVQPLNYRNSTLS
DSGVIDNLPDSPDEVAKELDLLGGWTDDKGSSKTYSNNPFWNGVQTNPFLNGNVPATPGV
DGLTPRSTVDLLLFDPGVSSFTESSSATTNSTGNIFDELPAANRVQAEAPSKRDNPFFRS
KRSYSLSELSVLQAKSDAPDSAGFFTGLKSPAPEQFQSREDFRAAWLSHRKLARSCHDLD
LLGQSPGWGQTQALETSIACKLDSSGGAVQLPDTNISIHVPEGHVAPGETQQIAMKALLD
PPLELNSDRCSSVSPVLEVKLSTLEVRTHIILEMKVSAEVKNDIFSKSTVGLQCLRSDLK
EGPYVPIPLTYSYGDTVQVQLDNLEPCMYLAIVAHGPNILYPSTVWDFINKKITVGLYGP
KHIHPSFKTVVTLFGHDCAPKTLMVSEVTRQAPCPAPVALQLWGKHQFVLSRPQDLHVCM
FSNMTNYEVKGSEQARVVRGFQMKLGKVSRLIFPVTCQNASELSDFTLRVQVKGDQEAIL
TQFCVQTPQPPPKSAIKPSGQRRFLKKNEVGKIILSPFAATTKYPTFQDRPVSSLKFGKL
LKTVVRQSKNHYLLEYKKGDAIALLSEEKIRLKGQLWTKEWYIGYHQGKVGLVHAKNVLV
VGRARPSLFSGPELSTSVLLEQILRPCKFLTYIYASVRTLLMENISSWRSFADALGYGNL
PLTFFCRAELDSEPERVASVLEKLKEDCNNTENKDRKSFQKELMMALLKMDCQGLVVRLI
QDFVLLTTAVEVAQRWRELAEKLAKVSKQQMDAYESPHRDRNGVVDSEAMWKPAYDFLLT
WSHQIGDSYRDVIQELHIGLDKMKNPITKRWKHLTGTLILVNSLDILRAAAFSPVDHDDF
VI
Download sequence
Identical sequences M3XTA8
ENSMPUP00000002308 ENSMPUP00000002308 XP_004777608.1.14098 XP_012903925.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]