SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002310 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002310
Domain Number 1 Region: 512-624
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.31e-40
Family Pyk2-associated protein beta ARF-GAP domain 0.00046
Further Details:      
 
Domain Number 2 Region: 6-137
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.19e-23
Family G proteins 0.00000666
Further Details:      
 
Domain Number 3 Region: 244-309,452-497
Classification Level Classification E-value
Superfamily PH domain-like 4.02e-17
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 
Domain Number 4 Region: 636-727
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.64e-16
Family Ankyrin repeat 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002310   Gene: ENSMPUG00000002334   Transcript: ENSMPUT00000002356
Sequence length 757
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897148.1:1367651:1732162:1 gene:ENSMPUG00000002334 transcript:ENSMPUT00000002356 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAGGRFKKEIVVDGQSYLLLIRDEGGPPEAQFAMWVDAVIFVFSLEDEISFQTVYHYYS
RMANYRNTSEIPLVLVGTQDAISSTNPRVIDDARARKLSSDLKRCTYYETCATYGLNVER
VFQDVAQKIVATRKKQQLSIGPCKSLPNSPSHSSVCSAQVSAVHISQTSNGGGSLSDYSS
SVPSTPSTSQKELRIDVPPTANTPTPVRKQSKRRSNLFTSRKGSDPDKEKKGLESRADSI
GSGRAIPIKQGMLLKRSGKSLNKEWKKKYVTLCDNGVLTYHPSLHDYMQNVHGKEIDLLR
TTVKVPGKRPPRATSACAPISSPKTNGLSKDMSSLHISPNSGNVTSASGSQMASGISLGS
FGSRPDGMQQRSYSVSSADQWSEATVIANSAISSDTGLGDSVCSSPSISSTTSPKLDPPP
SPHANRKKHRRKKSTSNFKADGLSGTAEEQEENFEFIIVSLTGQTWHFEATTYEERDAWV
QAIESQILASLQSCESSKNKSRLTSQSEAMALQSIRNIRGNSHCVDCETQNPNWASLNLG
ALMCIECSGIHRNLGTHLSRVRSLDLDDWPIELIKVMSSIGNELANSVWEESSQGRTKPS
MDSTREEKERWIRAKYEQKLFLAPLPCTELSLGQHLLRATADEDLRAVILLLAHGSREEV
NETCGEGDGRTALHLACRKGNVVLAQLLIWYGVDVMARDAHGNTALAYARQASSQECIDV
LLQYGCPDERFVLMATPNLSRKNNNRNSSSGRVPTII
Download sequence
Identical sequences M3XTB0
ENSMPUP00000002310 ENSMPUP00000002310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]