SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002321 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002321
Domain Number 1 Region: 348-482
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.05e-36
Family Synaptotagmin-like (S variant) 0.00085
Further Details:      
 
Domain Number 2 Region: 493-634
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.84e-33
Family Synaptotagmin-like (S variant) 0.0023
Further Details:      
 
Domain Number 3 Region: 8-129
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.88e-27
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002321   Gene: ENSMPUG00000002347   Transcript: ENSMPUT00000002369
Sequence length 671
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897137.1:1368935:1431864:1 gene:ENSMPUG00000002347 transcript:ENSMPUT00000002369 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEILDLSFLSEVERDLILSVLQRDEELRKADEKRIRRLKNELLEIKRKGAKRGSQHYSD
RTCARCQESLGRLTPKTNTCRGCNHLVCRDCRIQESNGTWRCKVCTKEIELKKATGDWFY
DQKVNRFAYHTGSEIIRMSLRRKPTVNKRETLGQSLLPQSQMDDIWPGRRIIQEQQKEPS
VLFEVPKPKSGRSALEAESESLDSYTADSDSLTRRDSLDKSGLFPEWKKMSAPASQVEKE
TQPGGQNVVSIDEGEMIFKKNTRKILRPSEYTKSVIDLRPEDVGHENGSLGDRSKSVPGL
SVDMEEEEEEEDIDHLVKLHRQKLARSSMRSGSSMSTIGSMTSIYSEAGDFGNIFVTGKI
AFSLKYEQQTQTLVIHVKECHQLAYADEAKKHSNPYVKTYLLPDKSRQGKRKTSIKRNTI
NPLYDETLRYEIPESLLAQRTLQFSVWHHGRFGRNTFLGEAEVQMDSWKLDKKLDHCLPL
HGKISAESLTGLPSHKGELVVSLKYIPASKLPVGGDRKKSKGGEGGELQVWIKEAKNLTA
AKSGGTSDSFVKGYLLPMRNKASKRKTPVMKKTLNPHYNHTFVYNGVRLEDLQHMCLELT
VWDREPLASNDFLGGVRLGVGTGISNGEVVDWMDSTGEEVSLWQKMRQYPGSWAEGTLHL
RSSMAKQKLGL
Download sequence
Identical sequences M3XTC1
XP_004777230.1.14098 XP_004777231.1.14098 ENSMPUP00000002321 ENSMPUP00000002321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]