SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002328 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002328
Domain Number 1 Region: 14-217
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.32e-70
Family Calponin-homology domain, CH-domain 0.000000727
Further Details:      
 
Domain Number 2 Region: 3066-3189
Classification Level Classification E-value
Superfamily EF-hand 3.23e-53
Family EF-hand modules in multidomain proteins 0.000000611
Further Details:      
 
Domain Number 3 Region: 3191-3287
Classification Level Classification E-value
Superfamily EF-hand 6.8e-40
Family EF-hand modules in multidomain proteins 0.00000394
Further Details:      
 
Domain Number 4 Region: 2037-2191
Classification Level Classification E-value
Superfamily Spectrin repeat 5.43e-24
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 5 Region: 978-1135
Classification Level Classification E-value
Superfamily Spectrin repeat 7.6e-24
Family Spectrin repeat 0.0038
Further Details:      
 
Domain Number 6 Region: 3267-3355
Classification Level Classification E-value
Superfamily RING/U-box 3.06e-21
Family ZZ domain 0.0092
Further Details:      
 
Domain Number 7 Region: 2506-2667
Classification Level Classification E-value
Superfamily Spectrin repeat 3.43e-20
Family Spectrin repeat 0.0075
Further Details:      
 
Domain Number 8 Region: 316-429
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-19
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 9 Region: 504-642
Classification Level Classification E-value
Superfamily Spectrin repeat 2.26e-19
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 10 Region: 2732-2859
Classification Level Classification E-value
Superfamily Spectrin repeat 8.23e-18
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 11 Region: 2882-3020
Classification Level Classification E-value
Superfamily Spectrin repeat 5.1e-17
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 12 Region: 1502-1657
Classification Level Classification E-value
Superfamily Spectrin repeat 1.67e-16
Family Spectrin repeat 0.0052
Further Details:      
 
Domain Number 13 Region: 1611-1755
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000777
Family Spectrin repeat 0.0059
Further Details:      
 
Domain Number 14 Region: 1216-1350
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000017
Family Spectrin repeat 0.0034
Further Details:      
 
Domain Number 15 Region: 2187-2304
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000024
Family Spectrin repeat 0.0076
Further Details:      
 
Domain Number 16 Region: 1806-1950
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000447
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 17 Region: 758-914
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000589
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 18 Region: 437-538
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000171
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 19 Region: 3028-3065
Classification Level Classification E-value
Superfamily WW domain 0.0000000000341
Family WW domain 0.00012
Further Details:      
 
Domain Number 20 Region: 2267-2397
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000446
Family Spectrin repeat 0.0084
Further Details:      
 
Domain Number 21 Region: 1105-1202
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000523
Family Spectrin repeat 0.0096
Further Details:      
 
Domain Number 22 Region: 2447-2523
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000259
Family Spectrin repeat 0.0048
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000002328
Domain Number - Region: 898-990
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00023
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number - Region: 1411-1538
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00101
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number - Region: 1322-1412
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00935
Family Spectrin repeat 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002328   Gene: ENSMPUG00000002354   Transcript: ENSMPUT00000002376
Sequence length 3626
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896981.1:2356326:4070147:1 gene:ENSMPUG00000002354 transcript:ENSMPUT00000002376 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSLSFIESAFKKFGKQHIENLFSDLQDGRRLLDLLEGLTGQKLPKEKGSTRVHALNNVNK
ALRVLQKNNVDLVNIGSTDIVDGNHKLTLGLIWNIILHWQVKNVMKNIMAGLQQTNSEKI
LLSWVRQSTRNYPQVNVINFTTSWSDGLALNALIHSHRPDLFDWNSVVGQQSAAQRLEHA
FNVAKYQLGIEKLLDPEDVATTYPDKKSILMYITSLFQVLPQQVSIEAIQEVEMLPRPSK
VTKEEHFQLHHQMHYSQQITVSLAQGYERTPSSPKPRFKSYAYTQAAYVATSEPTRSLLP
SQHLEAPEDKSFGRSLMEAEVNLDSYQTALEEVLSWLLSAEDTLQAQGEISNDVEEVKEQ
FHTHEGFMMDLTSHQGRVGNVLQLGSQLIGTGKLSEDEESEVQEQMNLLNSRWECLRVAS
MEKQSNLHKVLMDLQNQQLKELNDWLTKTEERTRKMEKEPLGPDIEDLKRQVQQHKVLQE
DLEQEQVRVNSLTHMVVVVDESSGDHATAALEEQLKVLGDRWANICRWTEDRWVLLQDVL
LKWQRFTEEQCLFSAWLSEKEDAVNKIHTTGFKDQSEVLSSLQKLAALKTDLEKKKQTMD
KLCSLNQDLLSALKNTLVAQKMEAWLDNFAQRWDNLVQKLEKSSAQISQAVTTAQPSLTQ
TTVMETVTMVTTREQILVKHAQEELPPPPPQKKRQIIVDSEIRKRLDVDITELHSWITRS
EAVLQSPEFAIYRKEGNFSDLKEKVNAIEREKAEKFRKLQDASRSAQALVEQMVNEGDNA
DSIKQASEQLNSRWIEFCQLLSERLNWLEYQNNIITFYNQLQQLEQMTTTAENWLKTQPT
TTTEPTVIKSQLKMCKDEVHQLSALQPQIERLKIQSTGLKEKGQGPMFLDADFVAFTNHF
NQVFADVQAREKELQTIFDILPPMRYQETMSTILTWIQQSETKLSIPQVNVTEYDIMEQR
LGELQALQRSLQEQQSGLNYLSTTVKEMSKKAPLSDISRKYQSEFEEIEGRWKKLSSQLV
EHCQKLEEQMAKLRKIQNHIKTLKKWMAEVDVFLKEEWPALGDPEILKRQLKQCRLLVND
IQTIQPSLNSVNEGAQMLKTEAEPEFASSLETELRELNTQWDYVCRQVYARKEALKGGLD
KTVSLQKDLSEMHEWMTQAEEEYLERDFEYKTPDELQTAVEEMKEEKEACQSAQSKLLAL
TQCILFSLSLSLPCFQESFEFQTAKLNSYYKWLLAPIQTKCEQYKEVWACWHELLSYLEK
ANKWLNEVEFKLKTTENIPGGAEEISEVLDSLENLMQHSEDNPNQIRILAQTLTDGGVMD
ELINEELETFNSRWRELHEEAVRRQKLLEQSIQSAQEIEKSLHLIQESLSSIDKQLAAYI
ADKVDAAQMPQEAQKIQSDLTSHEISLEEMKKHNQGKETAQRVLSQIDMAQKKLQDVSMK
FRLFQKPANFEQRLQESKMILDEVKMHLPALETKSVEQEVVQSQLNHCVNLYKSLSEVKS
EVEMVIKTGRQIVQKKQTENPKELDERVTALKLHYNELGAKVTERKQQLEKCLKLSRKMR
KEMNALTEWLAATDTELTKRSAVEGMPSNLDSEVAWGKATQKEIEKQKVHLKSVTELGEA
LKTVLGKKETLVEDKLSLLNSNWIAVTSRAEEWLNLLLEYQKHMENFDQNVDYITNWIIQ
AEALLDESEKRKPQQKEDILKRLKAEMNDMRPKVDSTRDQAAKLMANRGDHCRKVVEPKI
SELNHRFAAISHRIKTGKASIPLKELEQFNSDIQKLLEPLEAEIQQGVNLKEEDFNKDMS
EDNEGTVKELLQRGDNLQQRITDERKREEIKIKQQLLQTKHNALKDLRSQRRKKALEISH
QWYQYKRQADDLLKCLDDIEKKLSSLPEPRDERKIKEIDRELQKKKEELNAVRRQAEGLS
EDGAAVAVEPTQIQLSKRWREIESKFAQFRRLNFAQIHTVHEESVMVMTEDMPLEISYVP
STYLTEITHVSQALSEVEQLLNAPELCAKDFEDLFKQEESLKNIKDNLQQISGRIDIIHN
KKTAALHSATPAERAKLQEALSRLDVQWERVNKIYKARQGRFDRSVEKWRRFHYDMKMLN
QWLTETEQFLKKTQIPENWEHAKYKWYLKELQDGIGQRQTVVRVLNATGEEIIQQSSKPD
ASILQEKLGSLNLRWQEVCKQLAERKKRLEEQKNILSEFQRDVNEFVLWLEEADSIASIP
LEPGNEQQLKENLEQVKLLVEELPLRQGILKQLNETGGIVLVSAPINPEEQDKLENKLKQ
TNLQWIKVSRDLPEKQREIEAHIKDLGQIDEQLNHLLLWLSPIRNQLEIYNQPNQTGPFD
IKEIEVAVQGKQPDVERILSKGQHLYKEKPATQPVKRKLEDLSSDWKAVTHLLQELRAKQ
PGPAPGLTTVGAQKKKIAPSQTVTLVTQPAVTKETAISKLEMPSSLLLEVPALADFNRAW
TELTDWLSLLDRVIKSQRVMVGDLEDINEMIIKQKATLQDLEQRRPQLEELITAAQNLKN
KTSNQEARTIITDRIERIQSQWDEVQEHLQNRRQQLNEMLKDSTQWLEAKEEAEQVLGQA
RAKLESWKEAPYTMDAIQKKITETKQLAKDLRQWQINVDVANDLALKLLRDYSADDTRKV
HMITENINASWASIHKRVSEREAALEETHRLLQQFPLDLEKFLAWLTEAETTANVLQDAT
HKERLLEDSKGVRELMKQWQDLQGEIEAHTDIYHNLDENGQKVLRSLEGSDDAALLQRRL
DNMNFKWSELRKKSLNIRSHLEASSDQWKRLHLSLQELLVWLQLKDDELCQQAPIGGDFP
AVQKQNDVHRAFKRELKTKEPVIMSTLETVRIFVTEQPLEGLEKLYQEPRELPPEERAQN
VTRLLRKQAEEVNTEWEKLNLHSADWQRKIDEALERLQELQEATDELDLKLRQAEVIKGS
WQPVGDLLIDSLQDHLEKVKALRGEITPLKENVSYVNDLARQLTTLGIQLSPYNLNILED
LNTRWKLLQVAVEDRIRQLHEAHRDFGPASQHFLSTSVQGPWERAISPNKVPYYINHETQ
TTCWDHPKMTELYQSLADLNNVRFSAYRTAMKLRRLQKALCLDLLSLSAACEALDQHNLK
QNDQPMDILQVINCLTTIYDRLEQEHNNLVNVPLCVDMCLNWLLNVYDTGRTGRIRVLSF
KTGIISLCKAHLEDKYRYLFKQVASSTGFCDQRRLGLLLHDSIQIPRQLGEVASFGGSNI
EPSVRSCFQFANNKPEIEAALFLDWMRLEPQSMVWLPVLHRVAAAETAKHQAKCNICKEC
PIIGFRYRSLKHFNYDICQSCFFSGRVAKGHKMHYPMVEYCTPTTSGEDVRDFAKVLKNK
FRTKRYFAKHPRMGYLPVQTVLEGDNMETPVTLINFWPVDSAPASSPQLSHDDTHSRIEH
YASRLAEMENSNGSYLNDSISPNESIDDEHLLIQHYCQSLNQDSPLSQPRSPAQILISLE
SEERGELERILADLEEENRNLQAEYDRLKQQHEHKGLSPLPSPPEMMPTSPQSPRDAELI
AEAKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQPQAEAKVNGTTVSSPSTSLQ
RSDSSQPMLLRVVGSQTSESMGKRSL
Download sequence
Identical sequences M3XTC8
ENSMPUP00000002328 ENSMPUP00000002328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]