SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002349 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002349
Domain Number 1 Region: 85-524
Classification Level Classification E-value
Superfamily Ras GEF 4.58e-91
Family Ras GEF 0.0001
Further Details:      
 
Domain Number 2 Region: 647-735
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.97e-33
Family Ras-binding domain, RBD 0.000009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002349   Gene: ENSMPUG00000002376   Transcript: ENSMPUT00000002398
Sequence length 778
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897054.1:374403:380971:-1 gene:ENSMPUG00000002376 transcript:ENSMPUT00000002398 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPRPLRLLWDTSPPGGVVLSSFRSRDPEEGGGPGGQGVGGGQEEEEEEEEDEAPVSVWD
EEEDGATFTVTSRQYRPPDPSAPTPPPRSSRRLRAGTLEALVRHLLDARTSGADVTFTSA
FLATHRAFTSTPALLGLMADRLEALESHPTGELERTIGVAISVLSTWLASHPEDFGSEVK
GQLDRLESFLLRTGYAAGAGVGGGSADLIRNLRSRVDSQAPDLPKPLALPGDPPADPTDV
LVFLADHLAEQLTLLDAELFLSLVPSQCLGSLWGHRDRPGHSHLCPSVRATVTQFNKVAG
AVVSSVLGATSTGEGLGEVTIRPLRPPQRARLLEKWIRVAEECRLLRNFSSVYAVVSALQ
SSPIHRLRAAWGEAARDSLRVFSSLCHIFSEEDNYSQSRELLSQEVKLQPSLEPNSKKAP
RSGSRGGGVVPYLGTFLKDLVMLDAASKDELENGYINFDKRRKEFAVLSELRRLQNECRG
YDLRPDPDIQRWLHGLRPLTEAQSHQVSCEVEPAGTSDPPAPRVLRPTLVVSQWTEVLGS
VGGPTPLVSWDRPSVGGDEAPGTPAPLLTRLAQHMKWPSVSSLDSALESTPSLHSPADPS
HLSPPASSPRPSRGHRRSASCGSPLSGGAEGASKGTGYGCGGSGPGASDCRIIRVQMELG
EDGSVYKSILVTSQDKAPSVISRVLKKNNRDYAVASEYELVQLLPGERELTIPPSANVFY
AMDGASHDFLLRQRRRPSTATLALTSSPSASGTPPSEGGGGSFPRIKATGRKIARALF
Download sequence
Identical sequences M3XTE9
ENSMPUP00000002349 ENSMPUP00000002349 XP_004770663.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]