SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002351 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002351
Domain Number 1 Region: 610-814
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.09e-36
Family DBL homology domain (DH-domain) 0.00000425
Further Details:      
 
Domain Number 2 Region: 827-953
Classification Level Classification E-value
Superfamily PH domain-like 2.17e-27
Family Pleckstrin-homology domain (PH domain) 0.0002
Further Details:      
 
Domain Number 3 Region: 318-424
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000262
Family Spectrin repeat 0.0047
Further Details:      
 
Domain Number 4 Region: 41-192
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00000209
Family CRAL/TRIO domain 0.011
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000002351
Domain Number - Region: 430-523
Classification Level Classification E-value
Superfamily Spectrin repeat 0.036
Family Spectrin repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002351   Gene: ENSMPUG00000002378   Transcript: ENSMPUT00000002400
Sequence length 1037
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896912.1:2470303:2719722:-1 gene:ENSMPUG00000002378 transcript:ENSMPUT00000002400 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFWLQEEMAPQELSRRLATVITHVDEIMQQEIRPLVAVDIIEQLHRQFAILSGGRGKDG
APIITFPEFVGFKHLPEEDFLNVMTYLTSIPSVEAASIGFIIVIDRRRDKWSSIKASLTR
IAVAFPGNLQLIFILRPSRFIQRTFTDIGIKYYREEFKMKVPIVMLNSVSDLHGYIDKSQ
LTEDLGGTLEYHHSQWINHRTAIENFAMSLKTTAEMLQMFGACLATKELPSSVLSAEDLL
MSHTRRRDKLQDELKLLGKQGTTLLSCIQEPATKSPSSKLNPSELENVATMERLLLQLDE
TERAFNQFWSEHHLKLNQCLQLQHFERNFYEVKLALDSLLAEQVEFTDIGDSVICVEQLL
KEHKNLEEKGQDTLEKAKLLSIIGDQLIQSHHYAVDSIRPRCVELRHLCDDFINENKKKY
DILEKSLELHRQLDKVSQWCEAGIYLLASQAVDKCQSREGVDVALNDIEAFLSTAKEYQL
PSHMEFYNQFELILTIDVKARAQEVLQKLSDVQEIFHKRQMSLMKLAARQTRPVQPVAPH
PESSPKWVSPKTSHPCILAPLQRTSEETYAGTLEKEDDKTKFEVKNEEILESSHDGENPK
PEQLDSPENLSPTRRIIHDLLETEEIYIKEIKSIIDGYLTPMDFIWLKHLIPDVLQNNKE
FLFGNIRELYEFHNRTFLKELEKCTENPELLARCFLKRKEDLQIYFKYHKNLPRARTIWQ
ECQDCTFFGVCQRQLDHELPLFKYLRGPSQRLLKYQMLLKGLLDFESPEDLGIDPGDQEE
GLAKNGPKRTKDSTFSAELQQALAMLEDLIKSCELAMDLAAVTGCPDDIKKLGKLLMHGS
FNVWTVHKDRYKMKDFIRFKPSQRQIYLFERGIVFCKIRMEPSDQGLAPHYSFKKSMKLV
TLSIRQLGRGSSRKFEIAHRNGPEKYILQAASKEIRDCWFSEISKLLMEQQNSIKDIDEG
EGNGKRISSKGCSSREFISMETSEEPEGAEEMEKENSALSLSGLFQLDDSYESCSSKSVP
EMGESIQGKKEGGDEDM
Download sequence
Identical sequences M3XTF1
ENSMPUP00000002351 XP_004745556.2.14098 ENSMPUP00000002351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]