SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002358 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002358
Domain Number 1 Region: 19-355
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.35e-76
Family Protein kinases, catalytic subunit 0.00000193
Further Details:      
 
Domain Number 2 Region: 969-1028
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.5e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0024
Further Details:      
 
Domain Number 3 Region: 1046-1162
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000223
Family Pleckstrin-homology domain (PH domain) 0.028
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000002358
Domain Number - Region: 1193-1395,1428-1448
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 0.000115
Family Tricorn protease domain 2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002358   Gene: ENSMPUG00000002385   Transcript: ENSMPUT00000002407
Sequence length 1660
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896944.1:1545800:1617384:1 gene:ENSMPUG00000002385 transcript:ENSMPUT00000002407 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFIKAKPFTQLVKEMQLHREDFEIIKVIGRGAFGEVAVVRMKNTERIYAMKILNKWEMLK
RAETACFREERDVLVNGDCQWITTLHYAFQDENYLYLVMDYYVGGDLLTLLSKFEDKLPE
DMARFYIGEMVLAIDSIHQLHYVHSNRDIKPDNVLLDVNGHIRLADFGSCLKMNDDGTVQ
SSVAVGTPDYISPEILQAMEDGMGRYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGK
IMNHEERFQFPSHVTDVSEEAKDLIQRLICSRERRLGQNGIEDFKKHAFFEGLNWENIRN
LEAPYIPDVSSPSDTSNFDVDDDVLRNIEILPPGSHTGFSGLHLPFIGFTFTTESCFSDR
GSLKSIMQSSTLTRDEGVQRDLENSLQAEAYERRIRRLEQEKLELSRKLQESTQTVQSLH
GSARALGGSAREKEIKKLNEEIERLKSKIADSNRLERQLEDTVTLRQEHEDSTHRLKGLE
KQYRVVRQEKEDFHKQLVEASERLKSQARELKDAHQQRKLALQEFSELNERMAELRSQKQ
KVSRQLRDKEEEAEAAMQKMDSMRQEMRKSEKLRKELEARLEDAVAEASRERKLREHSEN
FSKQVESELEALKMKQGSRGPGAALEHQQEVSKIRSELEKKVLFYEEELVRREASHVLEV
KNVKKEVHDSESLQLALQKEVLMLKDKLEKSKRERHTEMEEAVGTVRDKYERERALLLEE
NKKLTAENERLCSFVDKLTAQNRQLEDELQGLAAKKESVAHWEAQIAEIIQWVSDEKDAR
GYLQALASKMTEELEALRSSSLGSRALDPLWKVRRSQKLDMSARLELQSALEAEIRAKQL
VQEELRKVKDTNLSFESKLKDSEAKNRELLEEMEILKKKMEEKFRADTGLKLPDFQDSIF
EYFNTAPLAHDLTFRSGSAGEQETQAPKPEVSPSVSVAASTEQQEDMARATQRPPAVPLP
TTQPLALAGPKPKAHQFSIKSFSSPTQCSHCTSLMVGLIRQGYACEVCSFACHVSCRESA
PQVCPIPPEQSKRPLGVDVQRGIGTAYKGYVKVPKPTGVKKGWQRAYAVVCDCKLFLYDL
PEGKSTQPGVVASQVLDLRDEEFSVSSVLASDVIHASRRDIPCIFRVTASLLGTPSKTSS
LLILTENENEKRKWVGILEGLQSILHKNRLKNQVVHIPQEAYDSTLPLIKAVLSAAVIDG
DRIVVGLEEGLYVIEVTRDVIVRVADYKKVHQIELAPKEKVAVLLCGRNHHVHLCPWSAF
DGAESSADVKLPETKGCQLIATATLRKSSSTCLFAAVKRLVLCYEVQRTRPFHRKVNEIV
APGTVQWMAALKDKLCVGYPSGFSLLSPQGDGQALTLVNPNDPSLTFLSQQSFDALCAVE
LKSEEYLLCFSHMGLYVDPQGRRSRMQELMWPAAPVACSCSPSHVTVYSEYGVDVFDVRT
MEWVQTIGLRRIRPLSSDGALNLLSCEPPRLIYFKSXSTGLGYCLTASRAESRGASLRSC
KKKRLLRNIFLQADSRAFHSKLVWCHCPWSEVSGPQLWSVVPGLQLGQGPDVLLPCRLSA
VPPSQEERPGPAPPNLSRQPPSRNKPYISWPSSGGSEPGVAVPLRSMSDPDQDFDKEPDS
DSTKHSTPSNSSNPSGPPSPNSPHRSQLPLEGLEQPAYDA
Download sequence
Identical sequences M3XTF8
ENSMPUP00000002358 ENSMPUP00000002358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]