SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002366 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002366
Domain Number 1 Region: 21-112
Classification Level Classification E-value
Superfamily Immunoglobulin 8.46e-33
Family V set domains (antibody variable domain-like) 0.0000542
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002366   Gene: ENSMPUG00000002393   Transcript: ENSMPUT00000002415
Sequence length 126
Comment pep:novel scaffold:MusPutFur1.0:GL897418.1:85436:86267:1 gene:ENSMPUG00000002393 transcript:ENSMPUT00000002415 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWTPLLLGLLAHCTGSMASYVLTQPPSVSVALGQTAQVTCTGNNIGSKHVYWYQQQPGH
IPVLIIYNSNKRPSGTPERFSGTGSGNTATLTISGAQAEDEADYYCHMLDSSADSHSDTG
RQGTET
Download sequence
Identical sequences M3XTG6
ENSMPUP00000002366 ENSMPUP00000002366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]