SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002370 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002370
Domain Number 1 Region: 1-122
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.2e-31
Family DBL homology domain (DH-domain) 0.00013
Further Details:      
 
Domain Number 2 Region: 270-380
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.29e-29
Family DEP domain 0.0035
Further Details:      
 
Domain Number 3 Region: 108-250
Classification Level Classification E-value
Superfamily PH domain-like 4.11e-22
Family Pleckstrin-homology domain (PH domain) 0.0036
Further Details:      
 
Domain Number 4 Region: 365-442
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.39e-16
Family DEP domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002370   Gene: ENSMPUG00000002397   Transcript: ENSMPUT00000002419
Sequence length 517
Comment pep:novel scaffold:MusPutFur1.0:GL897486.1:16389:90441:1 gene:ENSMPUG00000002397 transcript:ENSMPUT00000002419 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FRIYDEYCSNHEKAQKLLLELNKIRTIRTFLLNCMLLGGRKNTDVPLEGYLVTPIQRICK
YPLLLKKQELLKRTPRKHSDYAAVMEALQAMKAVCSNINEAKRQMEKLEVLEEWQSHIEG
WEDLNIIALCYKLSLHSFMLNLVSHFPFEERLIFLIDSVVMLCVATTRRLKNSKASTDGH
RYIFRGRINTEVMEVENVDDGTADFHSSGHIVVNGWKIHNTAKNKWFVCMAKTPEEKHEW
FEAILKERERRKGLKLGMEQDTWVMISEQGEKLYKMMCKQGNLIKDRKRKLTTFPKCFLG
SEFVSWLLDIGEIHRPEEGVHLGQALLENGIIHHVTDKHQFKPEQMLYRFRYDDGTFYPR
NEMQDVISKGVRLYCRLHSLFTPVIRDKDYHLRTYKSVVMANKLIDWLIAQGDCRTREEA
MIFGVGLCDNGFMHHGSLHIYAYKHILITLLPICQLLLEGYYLKNRLMKHDLKVVENVIA
KSLLIKSNEGSYGFGLEDKNKVPIIKLVEKGSNAEVM
Download sequence
Identical sequences M3XTH0
ENSMPUP00000002370 ENSMPUP00000002370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]